KEGG   Mycobacterium tuberculosis H37Rv: Rv1173Help
Entry
Rv1173            CDS       T00015                                 

Gene name
fbiC
Definition
(RefSeq) FO synthase
  KO
K11779  
FO synthase [EC:2.5.1.77]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Module
F420 biosynthesis
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Rv1173 (fbiC)
Enzymes [BR:mtu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.77  7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase
     Rv1173 (fbiC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
1302931..1305501
Genome map
AA seq 856 aa AA seqDB search
MPQPVGRKSTALPSPVVPPQANASALRRVLRRARDGVTLNVDEAAIAMTARGDELADLCA
SAARVRDAGLVSAGRHGPSGRLAISYSRKVFIPVTRLCRDNCHYCTFVTVPGKLRAQGSS
TYMEPDEILDVARRGAEFGCKEALFTLGDRPEARWRQAREWLGERGYDSTLSYVRAMAIR
VLEQTGLLPHLNPGVMSWSEMSRLKPVAPSMGMMLETTSRRLFETKGLAHYGSPDKDPAV
RLRVLTDAGRLSIPFTTGLLVGIGETLSERADTLHAIRKSHKEFGHIQEVIVQNFRAKEH
TAMAAFPDAGIEDYLATVAVARLVLGPGMRIQAPPNLVSGDECRALVGAGVDDWGGVSPL
TPDHVNPERPWPALDELAAVTAEAGYDMVQRLTAQPKYVQAGAAWIDPRVRGHVVALADP
ATGLARDVNPVGMPWQEPDDVASWGRVDLGAAIDTQGRNTAVRSDLASAFGDWESIREQV
HELAVRAPERIDTDVLAALRSAERAPAGCTDGEYLALATADGPALEAVAALADSLRRDVV
GDEVTFVVNRNINFTNICYTGCRFCAFAQRKGDADAYSLSVGEVADRAWEAHVAGATEVC
MQGGIDPELPVTGYADLVRAVKARVPSMHVHAFSPMEIANGVTKSGLSIREWLIGLREAG
LDTIPGTAAEILDDEVRWVLTKGKLPTSLWIEIVTTAHEVGLRSSSTMMYGHVDSPRHWV
AHLNVLRDIQDRTGGFTEFVPLPFVHQNSPLYLAGAARPGPSHRDNRAVHALARIMLHGR
ISHIQTSWVKLGVRRTQVMLEGGANDLGGTLMEETISRMAGSEHGSAKTVAELVAIAEGI
GRPARQRTTTYALLAA
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
gtgccgcagcctgtaggtcggaagtccaccgctctgccgagtcccgttgtaccgccccag
gcaaatgcctcagcgttgcggcgggtactgcgacgggcccgagatggtgtcacgctgaac
gtggatgaggcggccatagcgatgaccgcacgcggtgacgagctggccgacctgtgcgcg
agcgccgcgcgggtgcgcgatgcgggtctcgtgtcggccggccggcacgggcccagcggc
aggttggcgatcagctattcgcgcaaggtgtttatcccggtcacccggttatgccgggac
aattgccactattgcacgttcgtcaccgtgccgggcaagctacgcgcccaaggttccagc
acgtatatggaacccgacgagatcctcgacgttgcccgccgaggtgccgaattcggttgc
aaggaagcgctattcactctcggtgaccgtccggaggcgcgttggcgccaggcacgcgaa
tggctcggcgaacggggctatgactccacgttgtcctacgtgcgcgcgatggcaatccgt
gtgctggagcaaaccgggctgttgccgcacctgaacccgggtgtgatgagctggtcggag
atgtcgcggctcaaaccggtggcgccgtcgatgggcatgatgctggagacgacctcgcga
cggctgttcgaaaccaaggggctcgcccactacggcagccctgacaaagacccggcggtg
cggctgcgtgtcctgaccgacgccggccggttgtccattccgtttaccaccggtctgttg
gtcggcatcggcgagacgctatccgagcgcgccgatacgttacatgcgattcgcaagtcg
cacaaggagttcgggcatatccaagaagtgatcgtgcagaacttccgcgccaaggaacac
accgcgatggccgccttccccgatgccggaatcgaggattacctggcgacggttgcggtg
gcgcggctggtgctgggcccgggcatgcgcatccaggcgccgccgaacctggtgtctggc
gacgaatgccgggcgctggttggcgccggggtcgacgactggggcggtgtctcaccgttg
acgcccgaccatgtcaaccccgaacggccctggcccgctttggacgagctggcggcggtc
accgccgaagccggctacgacatggtgcagcggctgaccgcgcaacccaaatacgtacag
gcgggcgcggcgtggatcgacccgcgggtgcggggacatgtggtggcgctggcggatccg
gcgaccggcctggcccgcgacgtcaacccggtgggcatgccgtggcaggagcccgacgac
gtggcgtcctggggccgggtcgatctgggcgcagcgatcgacactcagggccgcaatacc
gcagtgcgcagcgacctggccagcgccttcggtgactgggaatcgatccgcgagcaggtg
cacgagctggcggtccgcgctccggaacgcattgacaccgatgtgcttgccgccctgcga
tcggcggagcgtgcgcccgccggctgcaccgacggcgagtatctggcgcttgccaccgcc
gacggtcctgcgctggaagccgttgccgcactggctgattcgttgcgccgcgatgtcgtc
ggcgacgaggtgacctttgtggtcaaccgtaacatcaacttcaccaacatctgctacacc
ggttgccggttctgcgcgttcgcccagcgaaagggtgacgccgacgcctactcgctgtcg
gtcggagaggtcgccgaccgggcatgggaggcccacgtcgccggggccaccgaagtatgc
atgcagggcggtatcgatcccgagctaccggtcaccggctacgccgatctggttcgtgcc
gtcaaggcgcgggtgccctccatgcatgtgcacgcgttttccccgatggagatcgccaac
ggcgtcaccaagagcgggctgagcattcgcgagtggctgatcggcctgcgcgaggccggg
ctggataccatcccgggtaccgccgcggaaatcctggacgacgaggttcgctgggtgctg
accaagggcaagctgccgacgtcattgtggatcgaaatcgtgacgaccgcccacgaggtg
ggtctgcggtcatcatcgacgatgatgtacgggcatgtggacagtccacggcactgggtc
gcccatcttaacgtgctgcgcgatattcaggaccgtaccggcggcttcaccgagttcgtc
ccgttgccgttcgtgcaccagaattcaccgttgtacctggccggtgcggcgcgccccggg
cccagccatcgcgacaaccgcgcggtacatgctttggcgcggatcatgttgcacggccgc
atctcgcacattcagaccagctgggtgaaacttggagtgcggcgcacccaggtgatgctc
gaaggtggcgccaacgacctgggcggcacgctgatggaggagaccatctcgcggatggcc
ggttccgaacacggatcggccaagaccgtcgctgagctggtcgcgatcgccgaaggcatc
ggccgcccggcgcgccagcgcactaccacatacgccctgcttgcggcctag

DBGET integrated database retrieval system