KEGG   Mycobacterium tuberculosis H37Rv: Rv1180Help
Entry
Rv1180            CDS       T00015                                 

Gene name
pks3
Definition
(RefSeq) polyketide beta-ketoacyl synthase
  KO
K12432  
mycolipanoate synthase [EC:2.3.1.252]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.252  mycolipanoate synthase
     Rv1180 (pks3)
Lipid biosynthesis proteins [BR:mtu01004]
 Others
  Multifunctional type
   Rv1180 (pks3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
1313725..1315191
Genome map
AA seq 488 aa AA seqDB search
MRTATATSVAVIGMACRLPGGIDSPQRLWEALLRGDDLVGEIPADRWDANVYYDPEPGVP
GRSVSRWGAFLDDVGGFDCDFFGLTEREATAIDPQHRLLLEVSWEAIEHAGVDPATLAES
QTGVFVGLTHGDYELLSADCGAAEGPYGFTGTSNSFASGRVAYTLGLHGPAVTVDTACSS
GLTAVHQACRSLDDGESDLALAGGVVVTLEPRKSVSGSLQGMLSPTGRCHAFDEAADGFV
SGEGCVVLLLKRLPDAVRDGDRVLAIVRGTAANQDGRTVNIAAPSAQAQIAVYQQALAAA
GVEASTVGMVEAHGTGTPVGDPVEYASLAAVYGTEGPCALTSVKTNFGHLQSASGPLGLM
KTILALRHGVVPQNLHFCRLPDQLAEIDTELFVPQANTSWPDNTGQPRRAAVSSYGMSGT
NVHAILEQAPVSEPAASGPELTPEAGGLALFPVSATSAEQLHVTAARLADWVDQNGNAGS
RVSMRDLG
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcaccgcaaccgccacatcggtcgccgttatcggcatggcttgccggctcccgggc
ggcatcgattccccacaacgcctctgggaagcgctgttacgcggcgacgatttggtgggt
gagattcccgctgaccggtgggacgcgaacgtgtactacgaccccgaacctggtgtccct
ggtcgatcggtatcgcgttggggcgcctttctggacgacgtcggcgggtttgactgcgat
ttcttcggcctgaccgagcgggaggcgaccgcgatcgacccacagcaccgcttgctgctg
gaagtgtcgtgggaggctatcgagcacgcgggtgtggacccggcgacgctcgctgaatca
caaacaggtgtcttcgtaggactgacacacggcgactacgagctgctgtccgcggattgc
ggcgccgcggaaggaccgtacggattcaccggcaccagtaacagtttcgcgtccgggcga
gtggcctacacactcggactgcatggccccgcggtcacggtggacaccgcgtgctcgtcc
gggttgacggctgtgcatcaagcctgccgcagcctggatgacggtgaaagcgatctcgct
cttgccggtggtgtggttgtcacgctagaaccgcggaagtccgtctcgggttccctgcaa
ggcatgttgtcgcctaccgggcgttgccatgccttcgacgaagcagctgatggcttcgtg
tccggtgaggggtgcgtggtcctgctgctgaagcggctaccggatgcggtgcgcgacggt
gatcgtgtgctggcgatcgttcgtggcaccgcagccaaccaggatggccgcaccgtgaat
atcgcggcgccgtcggcgcaggctcagatcgcggtgtatcagcaagcgttggctgcagcg
ggcgtcgaagcgtcgacggtggggatggtcgaagcccacggcaccggcacccccgttgga
gatccggtcgaatacgcgagcctggccgcggtgtacggaaccgagggtccgtgcgcgctg
acgtcggtgaaaacaaacttcggtcacctgcagtcggcatcggggcccctggggttgatg
aagacaatcctggcgttgcggcatggggttgtgccgcagaacctgcacttctgccggctg
cctgatcagctggctgagattgacactgaactctttgtgccgcaagcgaatacatcctgg
ccggacaacaccggacagccacgtcgcgctgcggtttcctcgtatggaatgtcgggtacc
aacgtgcatgccatcttggagcaagcgccggtatcagaaccagcggcttcgggacctgag
ctcactcccgaagccggtgggctggcgttgtttccggtgtcggctacctcggctgagcaa
ctacacgtcacggccgcccggctggcggattgggtcgaccagaacggcaacgcgggcagt
cgagttagcatgcgggacctgggctaa

DBGET integrated database retrieval system