KEGG   Mycobacterium tuberculosis H37Rv: Rv1187Help
Entry
Rv1187            CDS       T00015                                 

Gene name
rocA
Definition
(RefSeq) pyrroline-5-carboxylate dehydrogenase RocA
  KO
K00294  
1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rv1187 (rocA)
   00330 Arginine and proline metabolism
    Rv1187 (rocA)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     Rv1187 (rocA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
1329390..1331021
Genome map
AA seq 543 aa AA seqDB search
MDAITQVPVPANEPVHDYAPKSPERTRLRTELASLADHPIDLPHVIGGRHRMGDGERIDV
VQPHRHAARLGTLTNATHADAAAAVEAAMSAKSDWAALPFDERAAVFLRAADLLAGPWRE
KIAAATMLGQSKSVYQAEIDAVCELIDFWRFNVAFARQILEQQPISGPGEWNRIDYRPLD
GFVYAITPFNFTSIAGNLPTAPALMGNTVIWKPSITQTLAAYLTMQLLEAAGLPPGVINL
VTGDGFAVSDVALADPRLAGIHFTGSTATFGHLWQWVGTNIGRYHSYPRLVGETGGKDFV
VAHASARPDVLRTALIRGAFDYQGQKCSAVSRAFIAHSVWQRMGDELLAKAAELRYGDIT
DLSNYGGALIDQRAFVKNVDAIERAKGAAAVTVAVGGEYDDSEGYFVRPTVLLSDDPTDE
SFVIEYFGPLLSVHVYPDERYEQILDVIDTGSRYALTGAVIADDRQAVLTALDRLRFAAG
NFYVNDKPTGAVVGRQPFGGARGSGTNDKAGSPLNLLRWTSARSIKETFVAATDHIYPHM
AVD
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgatcacccaggtgccggttccggccaacgagccggtgcacgactatgcgccg
aaatccccggaacggacccggctgcgcaccgaactggcctccctggccgatcaccccatc
gacctgccgcacgtcatcggcggccgacaccggatgggcgacggcgagcgaatcgacgtc
gtgcagccgcaccggcacgccgccaggctgggcaccctgaccaacgccacccacgccgac
gccgcggccgccgtcgaagccgccatgtctgccaaaagtgactgggcggcactgccgttc
gatgaacgtgccgcggtgttcctgcgcgccgccgatctgttggccgggccgtggcgggaa
aagatcgccgccgcaaccatgctcggccaatccaagtcggtgtaccaggccgagatcgac
gcggtctgcgagctgatcgacttctggcggttcaacgtcgctttcgcccgacagattttg
gagcagcagccgatcagtggcccgggggaatggaaccggatcgactaccgcccgctggac
ggtttcgtctacgcgatcacgccgttcaacttcacctcgatcgccggcaatctgccgacc
gccccggctctgatgggcaacaccgtgatctggaagccgtcgatcacccagacgctggcg
gcctatctgaccatgcaactgctcgaggccgccgggttgccgcccggggtgatcaacctg
gtcactggcgacggattcgcggtttccgatgtggcactggccgatccacggctggccggc
atccacttcaccgggtcgacggctaccttcggccacctatggcagtgggtgggtaccaat
atcggccgctaccatagctatccgcgactggtcggcgagaccgggggcaaggacttcgtg
gtggcgcacgcctcggcccgcccggatgtgctgcgcacggccctgattcgcggagcattc
gattaccagggccagaagtgctcggcggtgtcgcgagcgtttatcgcgcattcggtgtgg
cagcggatgggcgatgagttgctggccaaagccgccgagctgcgctacggtgacatcacc
gacctgtccaactacggtggtgcgctgatcgaccagcgcgccttcgtcaagaacgtcgac
gccatcgaacgggccaaaggcgcggccgcggtcaccgtcgccgtcggcggcgaatacgac
gacagcgaaggctatttcgtgcgccccacggtgttgctctccgacgacccgaccgacgag
tcgtttgtcatcgagtacttcggtccgctgctgtcggtgcatgtctaccccgacgagcgc
tacgagcagatcctcgacgtcatcgacaccggatcccgctacgcgctgaccggcgcggtc
atcgccgacgaccggcaggccgtgctgaccgcgctggatcggctgcggttcgcggcgggg
aacttctatgtcaacgacaagccgacgggggcggtggtggggcgtcagccgttcggcggt
gcacgcggatcgggcaccaacgacaaggccggttcgccgttgaacctgctgcggtggacg
tcggcgcgcagcatcaaggagacgttcgtcgcggccaccgaccacatctacccgcacatg
gcggtcgactga

DBGET integrated database retrieval system