KEGG   Mycobacterium tuberculosis H37Rv: Rv1201cHelp
Entry
Rv1201c           CDS       T00015                                 

Gene name
dapD
Definition
(RefSeq) 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
  KO
K00674  
2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase [EC:2.3.1.117]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rv1201c (dapD)
  Amino acid metabolism
   00300 Lysine biosynthesis
    Rv1201c (dapD)
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.117  2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
     Rv1201c (dapD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1344216..1345169)
Genome map
AA seq 317 aa AA seqDB search
MSTVTGAAGIGLATLAADGSVLDTWFPAPELTESGTSATSRLAVSDVPVELAALIGRDDD
RRTETIAVRTVIGSLDDVAADPYDAYLRLHLLSHRLVAPHGLNAGGLFGVLTNVVWTNHG
PCAIDGFEAVRARLRRRGPVTVYGVDKFPRMVDYVVPTGVRIADADRVRLGAHLAPGTTV
MHEGFVNYNAGTLGASMVEGRISAGVVVGDGSDVGGGASIMGTLSGGGTHVISIGKRCLL
GANSGLGISLGDDCVVEAGLYVTAGTRVTMPDSNSVKARELSGSSNLLFRRNSVSGAVEV
LARDGQGIALNEDLHAN
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgaccgtgactggagcagcaggcatcggcctggctaccctcgccgctgacggatcg
gtcctcgacacctggtttcccgcgccggaactgaccgaatcgggcaccagcgcgacgtca
cgactggcggtgtccgacgttcctgtcgagctggccgcgctgatcggccgcgatgacgac
cgccgcaccgagaccatcgcggtccgtacggtcatcggctcgctcgacgatgtcgccgct
gacccatacgatgcttacctgcggcttcacctcttgtcgcaccgcctggtggcgccccat
gggttgaacgccggcggcttgtttggggtgctgaccaatgtggtgtggaccaatcacgga
ccctgcgccatagacggtttcgaggcggtgcgggcgcggctgcgccgccgcggaccggtg
actgtgtatggcgtcgacaagtttccccggatggtcgactacgtcgtgcccaccggcgta
cgtatcgccgatgccgaccgcgtgcggttgggcgctcacctggcgccgggcaccaccgtg
atgcatgagggcttcgtcaactacaacgccggcaccctgggcgcctcgatggtggaaggc
cgcatctcggcgggtgtggtggtgggcgacggctccgatgtcggcggcggagcgtcgatc
atgggcacgctgtctggcggtggaacacacgtcatttcgatcggcaagcgttgtctgctc
ggcgccaactccggtctgggcatctcactgggcgacgactgcgtggtggaggccgggctg
tacgtgaccgccggcacgagggtcaccatgcccgacagcaattcggtcaaggcgcgtgag
ctctccgggagcagcaacctgctgtttcgccgcaattccgtcagcggggcggtcgaagtg
ctggcccgcgacggtcagggcattgccctcaacgaggacctgcacgccaactag

DBGET integrated database retrieval system