KEGG   Mycobacterium tuberculosis H37Rv: Rv1223Help
Entry
Rv1223            CDS       T00015                                 

Gene name
htrA
Definition
(RefSeq) serine protease HtrA
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
1365875..1367461
Genome map
AA seq 528 aa AA seqDB search
MDTRVDTDNAMPARFSAQIQNEDEVTSDQGNNGGPNGGGRLAPRPVFRPPVDPASRQAFG
RPSGVQGSFVAERVRPQKYQDQSDFTPNDQLADPVLQEAFGRPFAGAESLQRHPIDAGAL
AAEKDGAGPDEPDDPWRDPAAAAALGTPALAAPAPHGALAGSGKLGVRDVLFGGKVSYLA
LGILVAIALVIGGIGGVIGRKTAEVVDAFTTSKVTLSTTGNAQEPAGRFTKVAAAVADSV
VTIESVSDQEGMQGSGVIVDGRGYIVTNNHVISEAANNPSQFKTTVVFNDGKEVPANLVG
RDPKTDLAVLKVDNVDNLTVARLGDSSKVRVGDEVLAVGAPLGLRSTVTQGIVSALHRPV
PLSGEGSDTDTVIDAIQTDASINHGNSGGPLIDMDAQVIGINTAGKSLSDSASGLGFAIP
VNEMKLVANSLIKDGKIVHPTLGISTRSVSNAIASGAQVANVKAGSPAQKGGILENDVIV
KVGNRAVADSDEFVVAVRQLAIGQDAPIEVVREGRHVTLTVKPDPDST
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
gtggatactagggtggacacggacaacgcgatgcctgcacgttttagcgcccagattcag
aatgaggatgaggtgacctccgaccaaggcaacaacggcggcccgaacggcggaggccgc
ctggcgccgcgcccggtttttcggccaccggtcgacccggcgtcgcgtcaagcgttcggg
cgtccgtccggggtccaagggtcctttgtggccgagcgtgtgcgcccgcagaagtaccag
gaccagtctgacttcacaccgaacgatcagcttgctgacccggtgcttcaggaggcgttc
ggtcgtccgttcgcgggcgccgaatcgctgcagcgccatcccatcgatgccggagcgctg
gcagctgagaaagacggtgccggccccgacgagcccgacgatccgtggcgcgaccccgcg
gccgcggccgcgctggggacgccagcgctagccgcgccggcaccgcacggtgcgctggcc
ggcagcggcaagctgggtgtgcgcgacgtgctgtttggcggcaaggtgtcctacttggcg
ctgggcatcttggtcgctatcgcactggtgatcggcggcatcggcggtgtcatcggccgc
aagaccgcggaagtagtcgatgcgttcaccacgtcgaaggtgaccctgtcgaccactggc
aatgcccaggaaccggccggccggttcaccaaggtggcggccgccgtggccgattcggtg
gtgaccattgagtcggtcagcgaccaggagggcatgcaaggttccggcgtcatcgtcgat
ggccgcggctacatcgtcaccaacaatcacgtgatctctgaggcggccaacaatcccagc
cagttcaagacgaccgtggtgttcaacgacggcaaggaggtgcccgccaatctggtgggt
cgtgaccccaagaccgacttggccgtcctcaaggtcgacaacgtcgacaatctgaccgtg
gcccggctcggtgattccagcaaggtacgggtcggtgacgaagtcctcgcggtcggcgcg
cccctggggctgcgcagtacggtgacccagggcattgtcagcgcgctacaccgccccgtt
ccgttgtcgggcgagggctctgacaccgacaccgtcattgacgcaattcagaccgacgcc
tcgatcaaccacggtaactccggcggtccgctaatcgacatggatgcccaggtgattggc
atcaacaccgccggtaagtcactgtcggatagcgccagcgggctgggctttgcgatcccg
gtcaacgagatgaaattggtggcaaattctctgatcaaagacggaaagatcgtgcatccg
acgttgggcatcagcacccggtcagtaagcaacgcgatcgcgtcgggcgcgcaggtggcc
aatgtaaaggcgggaagtcccgcgcagaagggcgggatcttggagaacgatgtgatcgtc
aaggtcggtaaccgcgcggtcgccgactccgacgagttcgtcgtcgccgtgcgccagttg
gctatcggccaggacgctccgatagaggtggtccgcgagggtcggcatgtgacgctgacg
gtgaaaccggaccccgatagcacctag

DBGET integrated database retrieval system