KEGG   Mycobacterium tuberculosis H37Rv: Rv1240Help
Entry
Rv1240            CDS       T00015                                 

Gene name
mdh
Definition
(RefSeq) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00020  Citrate cycle (TCA cycle)
mtu00270  Cysteine and methionine metabolism
mtu00620  Pyruvate metabolism
mtu00630  Glyoxylate and dicarboxylate metabolism
mtu00680  Methane metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
Module
mtu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mtu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mtu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rv1240 (mdh)
   00620 Pyruvate metabolism
    Rv1240 (mdh)
   00630 Glyoxylate and dicarboxylate metabolism
    Rv1240 (mdh)
  Energy metabolism
   00680 Methane metabolism
    Rv1240 (mdh)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Rv1240 (mdh)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     Rv1240 (mdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-GeneID: 887119
NCBI-ProteinID: NP_215756
TubercuList: Rv1240
UniProt: P9WK13 I6XB21
Structure
PDB: 

Jmol
Position
1383213..1384202
Genome map
AA seq 329 aa AA seqDB search
MSASPLKVAVTGAAGQIGYSLLFRLASGSLLGPDRPIELRLLEIEPALQALEGVVMELDD
CAFPLLSGVEIGSDPQKIFDGVSLALLVGARPRGAGMERSDLLEANGAIFTAQGKALNAV
AADDVRVGVTGNPANTNALIAMTNAPDIPRERFSALTRLDHNRAISQLAAKTGAAVTDIK
KMTIWGNHSATQYPDLFHAEVAGKNAAEVVNDQAWIEDEFIPTVAKRGAAIIDARGASSA
ASAASATIDAARDWLLGTPADDWVSMAVVSDGSYGVPEGLISSFPVTTKGGNWTIVSGLE
IDEFSRGRIDKSTAELADERSAVTELGLI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgctagtcctctcaaggtcgccgttaccggcgccgccggccaaatcggctacagc
ctgttgttccgcctggccagcggctctttgctgggccctgaccgtccgatcgagctgcgg
ctgctcgagatcgagccggcactgcaggcgctcgagggtgtggtgatggaactcgacgac
tgcgctttcccgctgttgtccggggtggagatcggttccgatccccagaagatcttcgat
ggtgtgagcctggccctgctggtcggagcccgcccccggggcgcgggcatggagcgaagt
gacctgctggaggccaacggcgcgatcttcaccgctcagggcaaagccctcaacgctgtc
gccgcggatgacgttcgcgtcggggtgaccggcaaccccgccaacaccaacgcgctgatc
gcgatgaccaatgcgcccgacattccccgcgagcggttctcggcgctcacccggctggac
cacaatcgggcgatctcgcagctggccgccaagaccggcgcggcggtcaccgacatcaag
aagatgacgatctggggcaatcactcggccacccagtaccccgacctgttccacgcggag
gtcgccggaaagaacgcggccgaagtggtcaacgaccaggcctggatcgaggatgaattc
atcccgacggtcgccaagcgcggtgcggcgatcatcgatgcgcgcggcgcgtcgtcggcc
gcctcggccgcgtcggcaaccatcgacgctgcccgggactggttgctggggacgccggcg
gacgattgggtctcgatggccgtcgtctccgacgggtcctacggggtgccggagggcttg
atctcctcgtttccggtcaccaccaagggcggcaactggacgatcgtgagcggcttggag
atcgacgagttctcccgcggccggatcgacaagtcaaccgccgagttggctgacgagcgc
agcgcggtcaccgagctcggcctgatctga

DBGET integrated database retrieval system