KEGG   Mycobacterium tuberculosis H37Rv: Rv1240Help
Entry
Rv1240            CDS       T00015                                 

Gene name
mdh
Definition
(RefSeq) malate dehydrogenase
  KO
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rv1240 (mdh)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rv1240 (mdh)
   00620 Pyruvate metabolism
    Rv1240 (mdh)
   00630 Glyoxylate and dicarboxylate metabolism
    Rv1240 (mdh)
  Energy metabolism
   00680 Methane metabolism
    Rv1240 (mdh)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Rv1240 (mdh)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     Rv1240 (mdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
1383213..1384202
Genome map
AA seq 329 aa AA seqDB search
MSASPLKVAVTGAAGQIGYSLLFRLASGSLLGPDRPIELRLLEIEPALQALEGVVMELDD
CAFPLLSGVEIGSDPQKIFDGVSLALLVGARPRGAGMERSDLLEANGAIFTAQGKALNAV
AADDVRVGVTGNPANTNALIAMTNAPDIPRERFSALTRLDHNRAISQLAAKTGAAVTDIK
KMTIWGNHSATQYPDLFHAEVAGKNAAEVVNDQAWIEDEFIPTVAKRGAAIIDARGASSA
ASAASATIDAARDWLLGTPADDWVSMAVVSDGSYGVPEGLISSFPVTTKGGNWTIVSGLE
IDEFSRGRIDKSTAELADERSAVTELGLI
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgctagtcctctcaaggtcgccgttaccggcgccgccggccaaatcggctacagc
ctgttgttccgcctggccagcggctctttgctgggccctgaccgtccgatcgagctgcgg
ctgctcgagatcgagccggcactgcaggcgctcgagggtgtggtgatggaactcgacgac
tgcgctttcccgctgttgtccggggtggagatcggttccgatccccagaagatcttcgat
ggtgtgagcctggccctgctggtcggagcccgcccccggggcgcgggcatggagcgaagt
gacctgctggaggccaacggcgcgatcttcaccgctcagggcaaagccctcaacgctgtc
gccgcggatgacgttcgcgtcggggtgaccggcaaccccgccaacaccaacgcgctgatc
gcgatgaccaatgcgcccgacattccccgcgagcggttctcggcgctcacccggctggac
cacaatcgggcgatctcgcagctggccgccaagaccggcgcggcggtcaccgacatcaag
aagatgacgatctggggcaatcactcggccacccagtaccccgacctgttccacgcggag
gtcgccggaaagaacgcggccgaagtggtcaacgaccaggcctggatcgaggatgaattc
atcccgacggtcgccaagcgcggtgcggcgatcatcgatgcgcgcggcgcgtcgtcggcc
gcctcggccgcgtcggcaaccatcgacgctgcccgggactggttgctggggacgccggcg
gacgattgggtctcgatggccgtcgtctccgacgggtcctacggggtgccggagggcttg
atctcctcgtttccggtcaccaccaagggcggcaactggacgatcgtgagcggcttggag
atcgacgagttctcccgcggccggatcgacaagtcaaccgccgagttggctgacgagcgc
agcgcggtcaccgagctcggcctgatctga

DBGET integrated database retrieval system