KEGG   Mycobacterium tuberculosis H37Rv: Rv1248cHelp
Entry
Rv1248c           CDS       T00015                                 

Definition
(RefSeq) multifunctional 2-oxoglutarate dehydrogenase E1 component/2-oxoglutarate dehydrogenase dihydrolipoyllysine-residue succinyltransferase
  KO
K01616  
2-oxoglutarate decarboxylase [EC:4.1.1.71]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Enzymes [BR:mtu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.71  2-oxoglutarate decarboxylase
     Rv1248c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(1389357..1393052)
Genome map
AA seq 1231 aa AA seqDB search
MANISSPFGQNEWLVEEMYRKFRDDPSSVDPSWHEFLVDYSPEPTSQPAAEPTRVTSPLV
AERAAAAAPQAPPKPADTAAAGNGVVAALAAKTAVPPPAEGDEVAVLRGAAAAVVKNMSA
SLEVPTATSVRAVPAKLLIDNRIVINNQLKRTRGGKISFTHLLGYALVQAVKKFPNMNRH
YTEVDGKPTAVTPAHTNLGLAIDLQGKDGKRSLVVAGIKRCETMRFAQFVTAYEDIVRRA
RDGKLTTEDFAGVTISLTNPGTIGTVHSVPRLMPGQGAIIGVGAMEYPAEFQGASEERIA
ELGIGKLITLTSTYDHRIIQGAESGDFLRTIHELLLSDGFWDEVFRELSIPYLPVRWSTD
NPDSIVDKNARVMNLIAAYRNRGHLMADTDPLRLDKARFRSHPDLEVLTHGLTLWDLDRV
FKVDGFAGAQYKKLRDVLGLLRDAYCRHIGVEYAHILDPEQKEWLEQRVETKHVKPTVAQ
QKYILSKLNAAEAFETFLQTKYVGQKRFSLEGAESVIPMMDAAIDQCAEHGLDEVVIGMP
HRGRLNVLANIVGKPYSQIFTEFEGNLNPSQAHGSGDVKYHLGATGLYLQMFGDNDIQVS
LTANPSHLEAVDPVLEGLVRAKQDLLDHGSIDSDGQRAFSVVPLMLHGDAAFAGQGVVAE
TLNLANLPGYRVGGTIHIIVNNQIGFTTAPEYSRSSEYCTDVAKMIGAPIFHVNGDDPEA
CVWVARLAVDFRQRFKKDVVIDMLCYRRRGHNEGDDPSMTNPYVYDVVDTKRGARKSYTE
ALIGRGDISMKEAEDALRDYQGQLERVFNEVRELEKHGVQPSESVESDQMIPAGLATAVD
KSLLARIGDAFLALPNGFTAHPRVQPVLEKRREMAYEGKIDWAFGELLALGSLVAEGKLV
RLSGQDSRRGTFSQRHSVLIDRHTGEEFTPLQLLATNSDGSPTGGKFLVYDSPLSEYAAV
GFEYGYTVGNPDAVVLWEAQFGDFVNGAQSIIDEFISSGEAKWGQLSNVVLLLPHGHEGQ
GPDHTSARIERFLQLWAEGSMTIAMPSTPSNYFHLLRRHALDGIQRPLIVFTPKSMLRHK
AAVSEIKDFTEIKFRSVLEEPTYEDGIGDRNKVSRILLTSGKLYYELAARKAKDNRNDLA
IVRLEQLAPLPRRRLRETLDRYENVKEFFWVQEEPANQGAWPRFGLELPELLPDKLAGIK
RISRRAMSAPSSGSSKVHAVEQQEILDEAFG
NT seq 3696 nt NT seq  +upstreamnt  +downstreamnt
gtggccaacataagttcaccattcgggcaaaacgaatggctggtcgaagagatgtaccgc
aagttccgcgacgacccctcctcggtcgatcccagctggcacgagttcctggttgactac
agccccgaacccacctcccaaccagctgccgaaccaacccgggttacctcgccactcgtt
gccgagcgggccgctgcggccgccccgcaggcaccccccaagccggccgacaccgcggcc
gcgggcaacggcgtggtcgccgcactggccgccaaaactgccgttcccccgccagccgaa
ggtgacgaggtagcggtgctgcgcggcgccgccgcggccgtcgtcaagaacatgtccgcg
tcgttggaggtgccgacggcgaccagcgtccgggcggtcccggccaagctactgatcgac
aaccggatcgtcatcaacaaccagttgaagcggacccgcggcggcaagatctcgttcacg
catttgctgggctacgccctggtgcaggcggtgaagaaattcccgaacatgaaccggcac
tacaccgaagtcgacggcaagcccaccgcggtcacgccggcgcacaccaatctcggcctg
gcgatcgacctgcaaggcaaggacgggaagcgttccctggtggtggccggcatcaagcgg
tgcgagaccatgcgattcgcgcagttcgtcacggcctacgaagacatcgtacgccgggcc
cgcgacggcaagctgaccactgaagactttgccggcgtgacgatttcgctgaccaatccc
ggaaccatcggcaccgtgcattcggtgccgcggctgatgcccggccagggcgccatcatc
ggcgtgggcgccatggaataccccgccgagtttcaaggcgccagcgaggaacgcatcgcc
gagctgggcatcggcaaattgatcactttgacctccacctacgaccaccgcatcatccag
ggcgcggaatcgggcgacttcctgcgcaccatccacgagttgctgctctcggatggcttc
tgggacgaggtcttccgcgaactgagcatcccatatctgccggtgcgctggagcaccgac
aaccccgactcgatcgtcgacaagaacgctcgcgtcatgaacttgatcgcggcctaccgc
aaccgcggccatctgatggccgataccgacccgctgcggttggacaaagctcggttccgc
agtcaccccgacctcgaagtgctgacccacggcctgacgctgtgggatctcgatcgggtg
ttcaaggtcgacggctttgccggtgcgcagtacaagaaactgcgcgacgtgctgggcttg
ctgcgcgatgcctactgccgccacatcggcgtggagtacgcccatatcctcgaccccgaa
caaaaggagtggctcgaacaacgggtcgagaccaagcacgtcaaacccactgtggcccaa
cagaaatacatcctcagcaagctcaacgccgccgaggcctttgaaacgttcctacagacc
aagtacgtcggccagaagcggttctcgctggaaggcgccgaaagcgtgatcccgatgatg
gacgcggcgatcgaccagtgcgctgagcacggcctcgacgaggtggtcatcgggatgccg
caccggggccggctcaacgtgctggccaacatcgtcggcaagccgtactcgcagatcttc
accgagttcgagggcaacctgaatccgtcgcaggcgcacggctccggtgacgtcaagtac
cacctgggcgccaccgggctgtacctgcagatgttcggcgacaacgacattcaggtgtcg
ctgaccgccaacccgtcgcatctggaggccgtcgacccggtgctggagggattggtgcgg
gccaagcaggatctgctcgaccacggaagcatcgacagcgacggccaacgggcgttctcg
gtggtgccgctgatgttgcatggcgatgccgcgttcgccggtcagggtgtggtcgccgag
acgctgaacctggcgaatctgccgggctaccgcgtcggcggcaccatccacatcatcgtc
aacaaccagatcggcttcaccaccgcgcccgagtattccaggtccagcgagtactgcacc
gacgtcgcaaagatgatcggggcaccgatctttcacgtcaacggcgacgacccggaggcg
tgtgtctgggtggcgcggttggcggtggacttccgacaacggttcaagaaggacgtcgtc
atcgacatgctgtgctaccgccgccgcgggcacaacgagggtgacgacccgtcgatgacc
aacccctacgtgtacgacgtcgtcgacaccaagcgcggggcccgcaaaagctacaccgaa
gccctgatcggacgtggcgacatctcgatgaaggaggccgaggacgcgctgcgcgactac
cagggccagctggaacgggtgttcaacgaagtgcgcgagctggagaagcacggtgtgcag
ccgagcgagtcggtcgagtccgaccagatgattcccgcggggctggccactgcggtggac
aagtcgctgctggcccggatcggcgatgcgttcctcgccttgccgaacggcttcaccgcg
cacccgcgagtccaaccggtgctggagaagcgccgggagatggcctatgaaggcaagatc
gactgggcctttggcgagctgctggcgctgggctcgctggtggccgaaggcaagctggtg
cgcttgtcggggcaggacagccgccgcggcaccttctcccagcggcattcggttctcatc
gaccgccacactggcgaggagttcacaccactgcagctgctggcgaccaactccgacggc
agcccgaccggcggaaagttcctggtctacgactcgccactgtcggagtacgccgccgtc
ggcttcgagtacggctacactgtgggcaatccggacgccgtggtgctctgggaggcgcag
ttcggcgacttcgtcaacggcgcgcagtcgatcatcgacgagttcatcagctccggtgag
gccaagtggggccaattgtccaacgtcgtgctgctgttaccgcacgggcacgaggggcag
ggacccgaccacacttctgcccggatcgaacgcttcttgcagttgtgggcggaaggttcg
atgaccatcgcgatgccgtcgactccgtcgaactacttccacctgctacgccggcatgcc
ctggacggcatccaacgcccgctgatcgtgttcacgcccaagtcgatgttgcgtcacaag
gccgccgtcagcgaaatcaaggacttcaccgagatcaagttccgctcagtgctggaggaa
cccacctatgaggacggcatcggagaccgcaacaaggtcagccggatcctgctgaccagt
ggcaagctgtattacgagctggccgcccgcaaggccaaggacaaccgcaatgacctcgcg
atcgtgcggcttgaacagctcgccccgctgcccaggcgtcgactgcgtgaaacgctggac
cgctacgagaacgtcaaggagttcttctgggtccaagaggaaccggccaaccagggtgcg
tggccgcgattcgggctcgaactacccgagctgctgcctgacaagttggccgggatcaag
cgaatctcgcgccgggcgatgtcagccccgtcgtcaggctcgtcgaaggtgcacgccgtc
gaacagcaggagatcctcgacgaggcgttcggctga

DBGET integrated database retrieval system