KEGG   Mycobacterium tuberculosis H37Rv: Rv1257cHelp
Entry
Rv1257c           CDS       T00015                                 

Definition
(RefSeq) oxidoreductase
  KO
K00104  
glycolate oxidase [EC:1.1.3.15]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rv1257c
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.15  (S)-2-hydroxy-acid oxidase
     Rv1257c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(1404717..1406084)
Genome map
AA seq 455 aa AA seqDB search
MNTDVLAGLMAELPEGMVVTDPAVTDGYRQDRAFDPSAGKPLAIIRPRRTEEVQTVLRWA
SANQVPVVTRGAGSGLSGGATALDGGIVLSTEKMRDITVDPVTRTAVCQPGLYNAEVKEA
AAEHGLWYPPDPSSFEICSIGGNIATNAGGLCCVKYGVTGDYVLGMQVVLANGTAVRLGG
PRLKDVAGLSLTKLFVGSEGTLGVITEVTLRLLPAQNASSIVVASFGSVQAAVDAVLGVT
GRLRPAMLEFMDSVAINAVEDTLRMDLDRDAAAMLVAGSDERGRAATEDAAVMAAVFAEN
GAIDVFSTDDPDEGEAFIAARRFAIPAVESKGALLLEDVGVPLPALGELVTGIARIAEER
NLMISVIAHAGDGNTHPLLVYDPADAAMLERAHLAYGEIMDLAVGLGGTITGEHGVGRLK
RPWLAGYLGPDVLALNQRIKQALDPQGILNPGSAI
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
gtgaataccgatgtgctggctggcctgatggccgagctgcccgaggggatggtggtcacc
gaccccgccgtcaccgacggctaccggcaagaccgggcctttgacccttcggccggcaaa
ccgctggcaatcatccggccacggcgcaccgaagaggtgcagacggtgctgcgttgggcc
agtgcgaaccaggtgcccgtggtgacccgaggagccggtagcggcctttcgggcggggcg
accgccctggatggcgggatcgtgctgtccaccgaaaagatgcgcgacatcaccgtcgac
ccggtcacccgcaccgcagtgtgccagcccggcctgtacaacgccgaggtgaaggaggcc
gccgccgaacacggcctgtggtatcccccggatccgtcgtcgttcgagatctgcagcatc
ggcggcaacatcgccaccaacgccggcgggctgtgctgcgtgaagtacggcgtcacaggc
gactacgtactgggcatgcaggttgtgctggccaacggcaccgcggtccggctgggcggc
ccacggctcaaggacgtcgccgggctttccctgaccaaactgttcgtcggcagcgaaggc
acgctgggcgtcatcacggaggtgacgttgcgactgctgcccgcacagaatgcatcgagc
atcgtggtggccagcttcggctcggtgcaggcggcggtcgatgcggtgctcggggttacc
ggccgacttcgccccgcgatgctggagttcatggattcggtggcgatcaacgccgtcgag
gacaccttgcggatggacctggaccgcgatgcggcggccatgctggtggctggttctgat
gaacgtggccgcgcggccaccgaagacgccgccgtgatggccgccgtgttcgccgaaaac
ggtgcgatagacgtgttttcgaccgacgacccggatgagggcgaggcgttcattgcggcc
cggcggttcgccattccggcggtcgagagcaagggggcgttgctgctcgaggacgtcggg
gtaccgctgcccgcactgggcgaactggtcaccgggattgcgcgcatcgccgaggagcgg
aatctgatgatctcggtgatcgcccacgccggggacggcaatacccacccgttgctggtg
tacgaccccgcagatgccgcgatgctagagcgcgcccacctcgcgtacggcgaaatcatg
gacctggccgtcggcctgggcggcacgatcaccggcgaacacggcgtgggccggttgaaa
cggccgtggttggccggctatctcgggcccgacgtcctggccctcaaccagcgcatcaag
caagcgctggacccccagggcatcctcaatcccggctcggcgatctga

DBGET integrated database retrieval system