KEGG   Mycobacterium tuberculosis H37Rv: Rv1285Help
Entry
Rv1285            CDS       T00015                                 

Gene name
cysD
Definition
(RefSeq) sulfate adenylyltransferase subunit 2
  KO
K00957  
sulfate adenylyltransferase subunit 2 [EC:2.7.7.4]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Purine metabolism
Monobactam biosynthesis
Selenocompound metabolism
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Module
Assimilatory sulfate reduction, sulfate => H2S
Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Rv1285 (cysD)
  Nucleotide metabolism
   00230 Purine metabolism
    Rv1285 (cysD)
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    Rv1285 (cysD)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Rv1285 (cysD)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     Rv1285 (cysD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
1437909..1438907
Genome map
AA seq 332 aa AA seqDB search
MAITINMVNPTGFIRYEDVEQEAMTSDVTVGPAPGQYQLSHLRLLEAEAIHVIREVAAEF
ERPVLLFSGGKDSIVMLHLALKAFRPGRLPFPVMHVDTGHNFDEVIATRDELVAAAGVRL
VVASVQDDIDAGRVVETIPSRNPIQTVTLLRAIRENQFDAAFGGARRDEEKARAKERVFS
FRDEFGQWDPKAQRPELWNLYNGRHHKGEHIRVFPLSNWTEFDIWSYIGAEQVRLPSIYF
AHRRKVFQRDGMLLAVHRHMQPRADEPVFEATVRFRTVGDVTCTGCVESSASTVAEVIAE
TAVARLTERGATRADDRISEAGMEDRKRQGYF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggcaataaccataaatatggtcaatcctaccggatttatcaggtatgaggacgtggaa
caggaagccatgaccagcgatgtgacggtgggccccgcacccggccagtaccaactgagc
catctgcgcttgctggaggccgaagccatccacgtcatccgggaggtggccgccgagttc
gagcggccagtgctgttgttctcggggggcaaggactccatcgtcatgctgcacctggcg
ctgaaggcgtttcggcccgggcgactgccgttcccggtcatgcacgtcgacaccggtcac
aacttcgacgaagttatcgctacccgagacgagttggtcgccgcggccggggtgcggctg
gtggtggcgtcggtgcaggacgatatcgatgccggtcgggtcgtcgagaccatcccgtcg
cgaaatccgatacagaccgtgacgctgctgcgggccatccgggagaaccaattcgacgcg
gcattcgggggagcccggcgcgacgaggagaaggcccgcgccaaggagcgggtgttcagc
ttccgcgacgagttcggccagtgggacccgaaggctcagcggccggaactgtggaacctc
tacaacggacggcaccacaagggcgagcacatccgggtcttcccgctgtccaactggacc
gaattcgacatctggtcctacatcggcgccgagcaggtcaggctgccgtccatctatttc
gcccaccggcgcaaggtgtttcagcgcgacggcatgttgctggccgtgcaccggcacatg
caaccgcgagccgacgagccggtgttcgaggccacggtgcgattccgcaccgtcggggat
gttacctgcaccgggtgcgtcgagtcgtcggcatcgacggtcgcggaagtcatcgccgaa
actgcggtggcccgcttgacggagcgcggggcgaccagggctgacgaccggatctcggag
gctggaatggaagaccgcaagcggcagggatacttctga

DBGET integrated database retrieval system