KEGG   Mycobacterium tuberculosis H37Rv: Rv1286Help
Entry
Rv1286            CDS       T00015                                 

Definition
(RefSeq) adenylyl-sulfate kinase
  KO
K00955  
bifunctional enzyme CysN/CysC [EC:2.7.7.4 2.7.1.25]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Purine metabolism
Monobactam biosynthesis
Selenocompound metabolism
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Module
Assimilatory sulfate reduction, sulfate => H2S
Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Rv1286
  Nucleotide metabolism
   00230 Purine metabolism
    Rv1286
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    Rv1286
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Rv1286
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.25  adenylyl-sulfate kinase
     Rv1286
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     Rv1286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
1438907..1440751
Genome map
AA seq 614 aa AA seqDB search
MTTLLRLATAGSVDDGKSTLIGRLLYDSKAVMEDQWASVEQTSKDRGHDYTDLALVTDGL
RAEREQGITIDVAYRYFATPKRKFIIADTPGHIQYTRNMVTGASTAQLVIVLVDARHGLL
EQSRRHAFLASLLGIRHLVLAVNKMDLLGWDQEKFDAIRDEFHAFAARLDVQDVTSIPIS
ALHGDNVVTKSDQTPWYEGPSLLSHLEDVYIAGDRNMVDVRFPVQYVIRPHTLEHQDHRS
YAGTVASGVMRSGDEVVVLPIGKTTRITAIDGPNGPVAEAFPPMAVSVRLADDIDISRGD
MIARTHNQPRITQEFDATVCWMADNAVLEPGRDYVVKHTTRTVRARIAGLDYRLDVNTLH
RDKTATALKLNELGRVSLRTQVPLLLDEYTRNASTGSFILIDPDTNGTVAAGMVLRDVSA
RTPSPNTVRHRSLVTAQDRPPRGKTVWFTGLSGSGKSSVAMLVERKLLEKGISAYVLDGD
NLRHGLNADLGFSMADRAENLRRLSHVATLLADCGHLVLVPAISPLAEHRALARKVHADA
GIDFFEVFCDTPLQDCERRDPKGLYAKARAGEITHFTGIDSPYQRPKNPDLRLTPDRSID
EQAQEVIDLLESSS
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgctattgcggctggcgacagcgggttccgtcgacgatggcaagtccacgctg
attgggcggctactctacgactccaaggctgtgatggaagaccagtgggcgtcggtggag
caaacgtccaaggaccggggccacgactacaccgacctggctctggtcaccgacggcctg
cgggccgagcgggaacagggcatcaccatcgacgttgcctaccgctacttcgccactccc
aagcggaaattcatcattgccgacaccccgggacacatccaatacacccgcaacatggtg
accggtgcgtccaccgcccaactggtgatcgtactggtggatgcccggcacggcttgctg
gagcaatcccgccggcacgccttcctggcgtcgctgctgggcatccgccacctggtgctc
gcggtcaacaagatggacttgcttggctgggaccaagagaaattcgacgcgattcgagac
gaattccacgccttcgcggcccgcctcgacgtgcaggacgtcacctccatcccaatctcc
gcgctgcacggcgacaacgtggtgaccaaatccgaccagacgccctggtacgagggaccg
tcgctgctgtcgcatctcgaagacgtctacatcgccggtgaccgcaacatggtcgacgtg
cgattcccggtccagtacgtcatccggccgcacaccctcgagcatcaagaccaccgcagc
tacgcgggcaccgtggccagtggggtaatgcgttcaggcgacgaagttgtcgtgctgccg
atcggtaagaccacccggatcaccgcgatcgacggcccgaacggcccggtggcagaagcg
tttccgccgatggcggtttcggtgcggctcgccgacgacatcgatatctcgcgtggtgac
atgatcgctcgcacccacaaccagcccaggatcacacaagaattcgacgcgaccgtgtgc
tggatggccgacaacgcggtgctagagcccggccgcgactacgttgtcaagcacaccacc
cgaaccgtccgcgcgaggatagccgggctggattaccggctcgatgtcaacaccctgcat
cgcgacaagaccgcaacggcgttgaaactcaacgaactgggccgtgtttcgctgcgcacc
caggtgccgttgctgcttgacgagtacacccgcaacgctagcaccggctcgttcatcctc
attgaccccgacaccaacggaacggtggcggcgggcatggtgttacgcgacgtctcggcc
cgcacgcctagcccgaacacggtgcggcacagatcgctcgtcactgcgcaagatcggccg
cccaggggcaagacggtgtggtttaccggactgtccggctccggcaagtcgtcggtggcc
atgctggttgagcggaagctactcgaaaagggcatctccgcttacgttctggacggcgac
aacctacggcatggcctcaacgccgacctgggcttttccatggccgaccgcgcggagaac
ctgcgccggctgtcgcatgtggccacactgctcgccgattgtggccacctggtgctggtg
cccgcgatcagcccccttgctgagcaccgtgccctggctcgtaaagtgcacgctgatgcg
ggaatcgactttttcgaggtgttctgtgacaccccgctgcaggactgtgagaggcgtgat
cccaaagggttgtacgccaaagcgcgtgcgggtgagatcacgcacttcaccgggatcgac
agcccatatcagcggcccaagaacccagacctacggcttacgccggatcgcagcatagac
gagcaggcgcaggaggttatcgacctgttggagtcatcgtcttag

DBGET integrated database retrieval system