KEGG   Mycobacterium tuberculosis H37Rv: Rv1293Help
Entry
Rv1293            CDS       T00015                                 

Gene name
lysA
Definition
(RefSeq) diaminopimelate decarboxylase
  KO
K01586  
diaminopimelate decarboxylase [EC:4.1.1.20]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Rv1293 (lysA)
Enzymes [BR:mtu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.20  diaminopimelate decarboxylase
     Rv1293 (lysA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
1448028..1449371
Genome map
AA seq 447 aa AA seqDB search
MNELLHLAPNVWPRNTTRDEVGVVCIAGIPLTQLAQEYGTPLFVIDEDDFRSRCRETAAA
FGSGANVHYAAKAFLCSEVARWISEEGLCLDVCTGGELAVALHASFPPERITLHGNNKSV
SELTAAVKAGVGHIVVDSMTEIERLDAIAGEAGIVQDVLVRLTVGVEAHTHEFISTAHED
QKFGLSVASGAAMAAVRRVFATDHLRLVGLHSHIGSQIFDVDGFELAAHRVIGLLRDVVG
EFGPEKTAQIATVDLGGGLGISYLPSDDPPPIAELAAKLGTIVSDESTAVGLPTPKLVVE
PGRAIAGPGTITLYEVGTVKDVDVSATAHRRYVSVDGGMSDNIRTALYGAQYDVRLVSRV
SDAPPVPARLVGKHCESGDIIVRDTWVPDDIRPGDLVAVAATGAYCYSLSSRYNMVGRPA
VVAVHAGNARLVLRRETVDDLLSLEVR
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgagctgctgcacttagcgccgaatgtgtggccgcgcaatactactcgcgatgaa
gtcggtgtggtctgcatcgcaggaattccactgacgcagctcgcccaggagtacgggacc
ccgctgttcgtcatcgacgaggacgactttcgctcgcgctgccgagaaaccgccgcggcc
tttggaagtggggcgaacgtgcactatgccgccaaggcgttcctgtgcagcgaagtagcc
cggtggatcagcgaagaagggctctgtctggacgtttgcaccggtggggagttggcggtc
gcgctgcacgctagctttccgcccgagcgaattaccttgcacggcaacaacaaatcggtc
tcagagttgaccgctgcggtcaaagccggagtcggccatattgtcgtcgattcgatgacc
gagatcgagcgcctcgacgccatcgcgggcgaggccggaatcgtccaggatgtcctggtg
cgtctcaccgtcggtgtcgaggcgcacacccacgagttcatctccaccgcgcacgaggac
cagaaattcgggttatcggtggccagcggcgcggccatggcagcggtgcggcgcgttttc
gccactgatcacctgcgcctggttgggctacacagccacatcggttcgcagatcttcgac
gtggacggcttcgaactcgccgcgcaccgtgtcatcggcctgctacgcgacgtcgtcggc
gagttcggtcccgaaaagacggcacagatcgcgaccgtcgatctcggtggcggcttgggc
atctcgtatttgccgtccgacgacccaccgccgatagccgagctcgcggccaagctgggt
accatcgtgagcgacgagtcaacggccgtggggctgccgacgcccaagctcgttgtggag
cccggacgcgccatcgccggaccgggcaccatcacgttgtatgaggtcggcaccgttaag
gacgtcgatgtcagcgccacagcgcatcgacgttacgtcagtgtcgacggcggcatgagc
gacaacatccgcaccgcgctctacggcgcgcagtatgacgtccggctggtgtctcgagtc
agcgacgccccgccggtaccggcccgtctggtcggaaagcactgcgaaagtggcgatatc
atcgtgcgggacacctgggtgcccgacgatattcggcccggcgatctggttgcggttgcc
gccaccggcgcttactgctattcgctgtcgagtcgttacaacatggtcggccgtcccgct
gtggtagcggtgcacgcgggcaacgctcgcctggtcctgcgtcgggagacggtcgacgat
ttgctgagtttggaagtgaggtga

DBGET integrated database retrieval system