KEGG   Mycobacterium tuberculosis H37Rv: Rv1294Help
Entry
Rv1294            CDS       T00015                                 

Gene name
thrA
Definition
(RefSeq) homoserine dehydrogenase
  KO
K00003  
homoserine dehydrogenase [EC:1.1.1.3]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rv1294 (thrA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv1294 (thrA)
   00270 Cysteine and methionine metabolism
    Rv1294 (thrA)
   00300 Lysine biosynthesis
    Rv1294 (thrA)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.3  homoserine dehydrogenase
     Rv1294 (thrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
1449375..1450700
Genome map
AA seq 441 aa AA seqDB search
MPGDEKPVGVAVLGLGNVGSEVVRIIENSAEDLAARVGAPLVLRGIGVRRVTTDRGVPIE
LLTDDIEELVAREDVDIVVEVMGPVEPSRKAILGALERGKSVVTANKALLATSTGELAQA
AESAHVDLYFEAAVAGAIPVIRPLTQSLAGDTVLRVAGIVNGTTNYILSAMDSTGADYAS
ALADASALGYAEADPTADVEGYDAAAKAAILASIAFHTRVTADDVYREGITKVTPADFGS
AHALGCTIKLLSICERITTDEGSQRVSARVYPALVPLSHPLAAVNGAFNAVVVEAEAAGR
LMFYGQGAGGAPTASAVTGDLVMAARNRVLGSRGPRESKYAQLPVAPMGFIETRYYVSMN
VADKPGVLSAVAAEFAKREVSIAEVRQEGVVDEGGRRVGARIVVVTHLATDAALSETVDA
LDDLDVVQGVSSVIRLEGTGL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
gtgcccggtgacgaaaagccggtcggcgtagcggtactcggtttgggcaacgtcggcagc
gaggttgtccgcatcatcgagaacagcgccgaggatctcgcggctcgtgtcggtgcccca
ttggtcctgcggggcatcggcgtgcgccgcgtgacgaccgatcgcggcgtgccgatcgaa
ttgttgaccgacgacattgaagagctcgtggcccgcgaggatgtcgatatcgtggtggaa
gtgatggggccggtggaaccgtcgcgcaaggcgatcctgggcgcccttgagcgcggcaag
tccgtcgttacggcgaacaaggctttactcgccacctccaccggcgaattggcacaggcc
gccgaaagcgcccatgttgatctgtatttcgaggcggccgtggcgggcgccattccggtc
atccgtccgctcacccagtcgctggccggcgacacggtgctgcgagtggccgggatcgtc
aacggcaccaccaactacatcctctcggcgatggacagcaccggcgctgactatgccagc
gccctggccgacgcaagtgcgctgggctatgcggaggctgatcccaccgcagacgtcgaa
ggctacgacgccgcggccaaggcagcgatcctggcatccattgccttccacacccgggtg
accgcagacgacgtgtatcgcgaaggcatcaccaaggtcactccggccgacttcggatcc
gcgcacgcgctgggttgcaccatcaaactgctgtcgatctgtgagcgcataaccaccgac
gaaggttcgcagcgggtatcggcccgcgtctatccggccctggtacctctgtcgcatccg
cttgccgcggtcaacggcgcgttcaatgccgtggtggtcgaggccgaggccgcgggccgg
ctgatgttctacggccagggcgcgggcggcgcgccgaccgcctctgcggtgaccggtgac
ctagtgatggccgcccgcaaccgggtactcggcagccgcggcccccgtgagtctaaatac
gctcaacttccggtggcaccaatgggtttcattgaaacgcgctattacgtcagcatgaac
gtcgccgacaagccgggcgtcttgtccgcggtggcggcggaattcgccaaacgcgaggtg
agcatcgccgaggtgcgccaggagggcgttgtggacgaaggtggtcgacgggtgggagcc
cgaatcgtggtggtcacgcacctcgccactgacgccgcactctcggaaaccgttgatgca
ctggacgacttggatgtcgtgcagggtgtgtccagcgtgatacgactggaaggaaccggc
ttatga

DBGET integrated database retrieval system