KEGG   Mycobacterium tuberculosis H37Rv: Rv1296Help
Entry
Rv1296            CDS       T00015                                 

Gene name
thrB
Definition
(RefSeq) homoserine kinase
  KO
K00872  
homoserine kinase [EC:2.7.1.39]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rv1296 (thrB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv1296 (thrB)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.39  homoserine kinase
     Rv1296 (thrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
1451997..1452947
Genome map
AA seq 316 aa AA seqDB search
MVTQALLPSGLVASAVVAASSANLGPGFDSVGLALSLYDEIIVETTDSGLTVTVDGEGGD
QVPLGPEHLVVRAVQHGLQAAGVSAAGLAVRCRNAIPHSRGLGSSAAAVVGGLAAVNGLV
VQTDSSPSSDAELIQLASEFEGHPDNAAAAVLGGAVVSWTDHSGDRPNYSAVSLRLHPDI
RLFTAIPEQRSSTAETRVLLPAQVSHDDARFNVSRAALLVVALTERPDLLMAATEDLLHQ
PQRAAAMTASAEYLRLLRRHNVAAALSGAGPSLIALSTDSELPTDAVEFGAAKGFAVTEL
TVGEAVRWSPTVRVPG
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggtgactcaagcattgttgccttctgggctggtggccagtgcggtggtggcggcgtcc
agtgcaaacctgggcccgggcttcgacagtgtcggtttggcgctgagtctctacgacgag
atcatcgtcgagacaacagattccggcttgacggtgactgtagacggcgagggcggcgac
caggtgccgctgggccccgagcacctcgtggtccgcgccgtgcagcacgggttacaggca
gcgggggtcagcgccgccggcctggcggtgcgctgccgcaacgccatcccgcactcccgc
ggcctcggctcctccgcggcagcagttgtgggcggtcttgcggccgttaacggtcttgtc
gtacaaacggattcgtcaccatcgagcgatgctgagctgattcagttggcttcggagttc
gagggtcatcccgacaacgcggcggccgcggttttgggtggtgccgtggtttcgtggact
gaccacagtggtgaccggcccaactattcggccgtatcactgcggcttcatcccgatatc
cgcctgttcactgcgattcccgagcagcgttcgtcgaccgcggaaacgcgggtgctattg
cccgcgcaggttagtcacgacgacgcacggttcaatgtcagtcgcgcggcgctgctggtg
gttgcgctcaccgaacggcccgatctgctgatggcggccaccgaagatctgcttcatcag
ccgcaacgtgccgcggcaatgacagcctccgcggaatatcttcggctgttgcggcgtcat
aacgtggcagcagcactgtccggggcaggtccttcgttgatcgccctgagtacagattca
gagttgccgaccgacgccgtggagttcggagccgcaaagggatttgccgttaccgagctg
actgttggcgaggcggttcgctggagcccgacagtaagagttcccggttaa

DBGET integrated database retrieval system