KEGG   Mycobacterium tuberculosis H37Rv: Rv1308Help
Entry
Rv1308            CDS       T00015                                 

Gene name
atpA
Definition
(RefSeq) ATP synthase subunit alpha
  KO
K02111  F-type H+-transporting ATPase subunit alpha [EC:3.6.3.14]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00190  Oxidative phosphorylation
mtu01100  Metabolic pathways
Module
mtu_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Rv1308 (atpA)
Enzymes [BR:mtu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.14  H+-transporting two-sector ATPase
     Rv1308 (atpA)
Photosynthesis proteins [BR:mtu00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   Rv1308 (atpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_C ATP-synt_ab_N AAA_25 ATPase
Motif
Other DBs
NCBI-GeneID: 886936
NCBI-ProteinID: NP_215824
TubercuList: Rv1308
UniProt: P9WPU7 I6XB71
Position
1463228..1464877
Genome map
AA seq 549 aa AA seqDB search
MAELTIPADDIQSAIEEYVSSFTADTSREEVGTVVDAGDGIAHVEGLPSVMTQELLEFPG
GILGVALNLDEHSVGAVILGDFENIEEGQQVKRTGEVLSVPVGDGFLGRVVNPLGQPIDG
RGDVDSDTRRALELQAPSVVHRQGVKEPLQTGIKAIDAMTPIGRGQRQLIIGDRKTGKTA
VCVDTILNQRQNWESGDPKKQVRCVYVAIGQKGTTIAAVRRTLEEGGAMDYTTIVAAAAS
ESAGFKWLAPYTGSAIAQHWMYEGKHVLIIFDDLTKQAEAYRAISLLLRRPPGREAYPGD
VFYLHSRLLERCAKLSDDLGGGSLTGLPIIETKANDISAYIPTNVISITDGQCFLETDLF
NQGVRPAINVGVSVSRVGGAAQIKAMKEVAGSLRLDLSQYRELEAFAAFASDLDAASKAQ
LERGARLVELLKQPQSQPMPVEEQVVSIFLGTGGHLDSVPVEDVRRFETELLDHMRASEE
EILTEIRDSQKLTEEAADKLTEVIKNFKKGFAATGGGSVVPDEHVEALDEDKLAKEAVKV
KKPAPKKKK
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggctgagttgacaatccccgctgatgacatccagagcgcaatcgaagagtacgtaagc
tctttcaccgccgacaccagtagagaggaagtcggtaccgtcgtcgatgccggggacggc
atcgcacacgtcgagggtttgccatcggtgatgacccaagagctgctcgaattcccgggc
ggaatcctcggcgtcgccctcaacctcgacgagcacagcgtcggcgcggtgatcctcggt
gacttcgagaacatcgaagaaggtcagcaggtcaagcgcaccggcgaagtcttatcggtt
ccggttggcgacgggtttttggggcgggtggttaacccgctcggccagccgatcgacggg
cgcggagacgtcgactccgatactcggcgcgcgctggagctccaggcgccctcggtggtg
caccggcaaggcgtgaaggagccgttgcagaccgggatcaaggcgattgacgcgatgacc
ccgatcggccgcggccagcgccagctgatcatcggcgaccgcaagaccggcaaaaccgcc
gtctgcgtcgacaccatcctcaaccagcggcagaactgggagtccggtgatcccaagaag
caggtgcgctgtgtatacgtggccatcgggcagaagggaactaccatcgccgcggtacgc
cgcacactggaagagggcggtgcgatggactacaccaccatcgtcgcggccgcggcgtcg
gagtccgccggtttcaaatggcttgcgccgtacaccggttcggcgatcgcccagcactgg
atgtacgagggcaagcatgtgctgatcatcttcgacgacctgactaagcaggccgaggca
taccgggcgatctcgctgctgctgcgccgtccgcccggccgtgaggcctaccccggcgat
gtgttctatctgcattcgcggcttttggagcgctgcgccaaactgtccgacgatctcggt
ggcggctcgctaacgggtctgccgatcatcgagaccaaggccaacgacatctcggcctac
atcccgaccaacgtcatctcgatcaccgacgggcaatgtttcctggaaaccgacctgttc
aaccagggcgtccggccggccatcaacgtcggtgtgtcggtgtcccgagtcggcggcgcg
gcgcagatcaaggctatgaaagaggtcgccggaagcctccgcttggacctttcgcaatac
cgcgagctagaagctttcgccgctttcgcttctgatttggacgccgcatcgaaggcgcag
ttggagcgcggcgcccggctggtcgagctgctcaagcagccgcaatcccagcccatgccc
gttgaggagcaagtggtttcgatcttcctgggcaccggcggtcacctggactcggtgccc
gtcgaggacgtccggcggttcgaaaccgaattactggaccacatgcgggcctccgaagaa
gagattttgactgagatccgggacagccaaaagctcaccgaggaggccgccgacaagctc
accgaggtcatcaagaacttcaagaagggcttcgcggccaccggtggcggctctgtggtg
cccgacgaacatgtcgaggccctcgacgaggataagctcgccaaggaagccgtgaaggtc
aaaaagccggcgccgaagaagaagaaatag

DBGET integrated database retrieval system