KEGG   Mycobacterium tuberculosis H37Rv: Rv1338Help
Entry
Rv1338            CDS       T00015                                 

Gene name
murI
Definition
(RefSeq) glutamate racemase
  KO
K01776  
glutamate racemase [EC:5.1.1.3]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Rv1338 (murI)
Enzymes [BR:mtu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     Rv1338 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:mtu01011]
 Precursor biosynthesis
  Racemase
   Rv1338 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
1505075..1505890
Genome map
AA seq 271 aa AA seqDB search
MNSPLAPVGVFDSGVGGLTVARAIIDQLPDEDIVYVGDTGNGPYGPLTIPEIRAHALAIG
DDLVGRGVKALVIACNSASSACLRDARERYQVPVVEVILPAVRRAVAATRNGRIGVIGTR
ATITSHAYQDAFAAARDTEITAVACPRFVDFVERGVTSGRQVLGLAQGYLEPLQRAEVDT
LVLGCTHYPLLSGLIQLAMGENVTLVSSAEETAKEVVRVLTEIDLLRPHDAPPATRIFEA
TGDPEAFTKLAARFLGPVLGGVQPVHPSRIH
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaattcgccgttggcgcccgtcggagtctttgattccggcgtcgggggactgacggtc
gcgcgggccatcatcgaccaactgcccgacgaggacatcgtctacgtcggcgacaccggt
aacggcccgtacggtccgctgaccatcccggagatccgggcgcacgcgctggccatcggc
gacgatctggtcggccgaggcgtcaaggcgttggtgatcgcctgcaactcggcgtcgtcg
gcgtgcctgcgggatgctcgcgagcgctaccaggtgcccgtcgtcgaagtgatactgccg
gcggtgcggcgtgcggtggccgccacccgcaacggccgcatcggggtaatcggcacgcgg
gcgaccatcacttcacacgcctatcaggacgcgttcgctgcggcccgcgacaccgaaatc
accgcggtggcttgccctcgcttcgtggacttcgtcgagcgcggcgtcaccagcggtcgt
caggtgctcggtctggcgcagggctacctggaaccgctgcagcgcgccgaggtcgacacg
ctagtgctgggctgtacgcactatccactgctgtccggactgattcaactggcgatgggc
gagaacgtcacgctggtctccagcgccgaggagaccgctaaggaagtggtccgggtgctc
accgagatcgacttattgcgtccgcatgacgcgccgccggcaactcggatatttgaagct
acgggcgaccccgaagcgtttaccaaattggccgcacgattcctgggtccggtgctcggt
ggtgtgcaacccgttcacccatcgcgcattcattag

DBGET integrated database retrieval system