KEGG   Mycobacterium tuberculosis H37Rv: Rv1380Help
Entry
Rv1380            CDS       T00015                                 

Gene name
pyrB
Definition
(RefSeq) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00240  Pyrimidine metabolism
mtu00250  Alanine, aspartate and glutamate metabolism
mtu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rv1380 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rv1380 (pyrB)
Enzymes [BR:mtu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Rv1380 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-GeneID: 886771
NCBI-ProteinID: NP_215896
TubercuList: Rv1380
UniProt: P9WIT7 I6XBC8
Position
1553232..1554191
Genome map
AA seq 319 aa AA seqDB search
MTPRHLLTAADLSRDDATAILDDADRFAQALVGRDIKKLPTLRGRTVVTMFYENSTRTRV
SFEVAGKWMSADVINVSAAGSSVGKGESLRDTALTLRAAGADALIIRHPASGAAHLLAQW
TGAHNDGPAVINAGDGTHEHPTQALLDALTIRQRLGGIEGRRIVIVGDILHSRVARSNVM
LLDTLGAEVVLVAPPTLLPVGVTGWPATVSHDFDAELPAADAVLMLRVQAERMNGGFFPS
VREYSVRYGLTERRQAMLPGHAVVLHPGPMVRGMEITSSVADSSQSAVLQQVSNGVQVRM
AVLFHVLVGAQDAGKEGAA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaccccaaggcacctgctgaccgccgccgacctcagccgcgacgacgccaccgccatc
ctcgacgacgccgaccggtttgcgcaggcgctggtcggtcgcgacatcaagaagctgccg
acgctgcggggccggaccgtcgtcacgatgttctatgagaactccacccgcacccgggtg
tcgttcgaggtagcgggtaagtggatgagcgccgacgtgatcaacgtcagcgctgccgga
tcttcggtaggcaagggtgagtcgctgcgggataccgcgctgaccctgcgcgcggccggg
gctgacgcgctgatcatccgccatcccgcgtccggcgccgcccatctgctggcgcagtgg
accggcgcccacaacgatgggccggcggtgatcaacgccggtgacggcactcatgaacac
cccacgcaggcgctgcttgatgcgctgaccatccgtcagcgcctcggcggcatcgaaggc
cggcgcatcgtgatcgtcggcgacatcctgcacagccgggtcgcccgctccaacgtcatg
ctgctggacaccctgggcgccgaggtggtgctggtggcgccacccacattgctaccggtc
ggggtgaccggctggccggccaccgtctcccacgacttcgatgccgagctgcccgccgcc
gacgcggtattgatgctgcgggtacaggccgagcggatgaacggcggttttttcccgtcc
gtacgggagtactcggtccgctacgggctaaccgagcggcgccaggcgatgcttcccggc
cacgccgtggtgttgcacccgggaccgatggtgcgtggcatggagatcacatcttcggtc
gcggactcgtcgcaatcggctgtgctgcaacaggtttccaatggagtccaggtgcggatg
gcggtgctgttccatgtgctggtgggagcgcaggatgccggtaaagagggtgcggcgtga

DBGET integrated database retrieval system