KEGG   Mycobacterium tuberculosis H37Rv: Rv1383Help
Entry
Rv1383            CDS       T00015                                 

Gene name
carA
Definition
(RefSeq) carbamoyl-phosphate synthase small subunit
  KO
K01956  
carbamoyl-phosphate synthase small subunit [EC:6.3.5.5]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rv1383 (carA)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rv1383 (carA)
Enzymes [BR:mtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     Rv1383 (carA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
1555971..1557101
Genome map
AA seq 376 aa AA seqDB search
MSKAVLVLEDGRVFTGRPFGATGQALGEAVFSTGMSGYQETLTDPSYHRQIVVATAPQIG
NTGWNGEDSESRGERIWVAGYAVRDPSPRASNWRATGTLEDELIRQRIVGIAGIDTRAVV
RHLRSRGSMKAGVFSDGALAEPADLIARVRAQQSMLGADLAGEVSTAEPYVVEPDGPPGV
SRFTVAALDLGIKTNTPRNFARRGIRCHVLPASTTFEQIAELNPHGVFLSNGPGDPATAD
HVVALTREVLGAGIPLFGICFGNQILGRALGLSTYKMVFGHRGINIPVVDHATGRVAVTA
QNHGFALQGEAGQSFATPFGPAVVSHTCANDGVVEGVKLVDGRAFSVQYHPEAAAGPHDA
EYLFDQFVELMAGEGR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
ttgagcaaagccgtattggtcctcgaagacggccgggtgttcaccggcaggccgttcggc
gcgaccggacaagcgctcggggaggccgtgttttccaccggcatgtccggttatcaggag
acgctgaccgatcccagctatcaccgtcagatcgtggtggccaccgcgccgcagatcggc
aacaccggctggaacggcgaggactccgaaagccgaggggagcggatctgggtcgccggt
tacgcggtgcgcgacccgtcgccgcgcgcgtccaactggcgcgccaccggcacgttggaa
gacgaactcatccgccagcgcatcgtcgggatcgccggcatcgacacccgggccgtggtg
cgccatctgcgcagccgcgggtcgatgaaggcgggggtgttctccgacggggcgctggcc
gagcctgccgacttgatcgcgcgggtgcgagcacaacagtcgatgctgggcgccgatctg
gccggcgaggtcagcaccgcggagccgtatgtcgtcgaacccgacgggccaccgggtgtt
tcgaggttcaccgtggccgccctagatcttggtatcaagaccaacactccgcgtaacttc
gcccggcgcgggattcgctgccatgtgctgccggcatcgaccaccttcgagcagatcgcc
gaactcaacccgcatggcgtgttcttgtccaacggccccggcgacccggccaccgccgat
cacgtcgtcgcgcttacccgcgaggtgctgggcgccggaatcccgttgttcggcatctgt
ttcggcaaccagatcctgggccgcgcgctgggcctgtcgacctacaagatggtgtttggg
caccgcggcatcaacatcccggtcgtcgaccacgccaccggtcgggtggcggtgaccgcg
caaaaccatggcttcgcccttcagggggaggcgggccaatccttcgccaccccgttcggt
cccgcggtggtcagccacacctgcgccaacgacggtgtggtcgaaggcgtcaagctcgtt
gacgggcgggcgttttcggtgcaataccacccggaagccgccgccggcccgcacgatgcc
gagtacctgttcgaccagttcgtggagctgatggcaggggagggccgctag

DBGET integrated database retrieval system