KEGG   Mycobacterium tuberculosis H37Rv: Rv1391Help
Entry
Rv1391            CDS       T00015                                 

Gene name
dfp
Definition
(RefSeq) bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase
  KO
K13038  
phosphopantothenoylcysteine decarboxylase / phosphopantothenate--cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Module
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Rv1391 (dfp)
Enzymes [BR:mtu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     Rv1391 (dfp)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase
     Rv1391 (dfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
1565441..1566697
Genome map
AA seq 418 aa AA seqDB search
MVDHKRIPKQVIVGVSGGIAAYKACTVVRQLTEASHRVRVIPTESALRFVGAATFEALSG
EPVCTDVFADVPAVPHVHLGQQADLVVVAPATADLLARAAAGRADDLLTATLLTARCPVL
FAPAMHTEMWLHPATVDNVATLRRRGAVVLEPATGRLTGADSGAGRLPEAEEITTLAQLL
LERHDALPYDLAGRKLLVTAGGTREPIDPVRFIGNRSSGKQGYAVARVAAQRGADVTLIA
GHTAGLVDPAGVEVVHVSSAQQLADAVSKHAPTADVLVMAAAVADFRPAQVATAKIKKGV
EGPPTIELLRNDDVLAGVVRARAHGQLPNMRAIVGFAAETGDANGDVLFHARAKLRRKGC
DLLVVNAVGEGRAFEVDSNDGWLLASDGTESALQHGSKTLMASRIVDAIVTFLAGCSS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtggtggaccataaacggatccccaagcaggtaatagtcggtgtctccgggggcatcgcc
gcctacaaggcgtgcacggttgttcgtcaactcaccgaggccagtcatcgcgtccgagtc
attcccaccgaatccgccctgcgcttcgtcggtgccgcgaccttcgaggcgctctccggt
gagccggtgtgcaccgacgttttcgccgacgttccggcggtcccgcatgttcacctcggc
cagcaggccgatctggtcgtagtggcgccggccaccgccgacctgctggcccgcgcggcg
gccggtcgagccgacgatctgctgaccgcgacgctgctgacggcgcggtgtccggtgctg
ttcgcgccggcgatgcacaccgagatgtggttgcatccggccaccgtcgacaacgtggcc
acgctgcgccgccgcggcgcggtggtgctcgagcccgcgacaggacggcttaccggcgcc
gacagcggggccggccgactgcccgaggcggaggagatcaccaccctcgcccagctgctg
ctggagcggcacgacgccctgccctacgatctcgcggggcgaaagctgctggttaccgcc
ggtggcacacgcgagccgatcgatccggtgcgctttatcggcaaccgcagctccggcaag
cagggctatgcggtggcgcgggtggccgcccagcgcggcgccgacgttactttgatcgct
gggcataccgcagggctcgtcgatcccgccggcgtcgaggtggtgcacgtcagctcggcc
cagcaactcgccgacgcggtgtccaagcacgctccgaccgccgacgtattggtgatggcg
gcggccgtcgccgacttccggcccgcgcaggttgccaccgccaaaatcaagaaaggcgtc
gaaggcccaccgaccatcgagctgctgcgcaacgacgacgtgctggccggggtggtgcgg
gcccgagcccatggacaactgcccaacatgcgggccattgtgggcttcgcagccgagacc
ggcgacgccaatggcgacgtgctctttcatgcccgagctaaactgcgacgcaaaggctgc
gatctgttagtcgtcaatgccgtcggcgaaggcagggcctttgaggtagacagcaacgac
ggctggctactggcgtccgatggtaccgagtcggcattgcagcacggctccaagacactg
atggcgagccgtatcgttgatgcaatcgtcacgttcctggcaggctgtagcagctaa

DBGET integrated database retrieval system