KEGG   Mycobacterium tuberculosis H37Rv: Rv1392Help
Entry
Rv1392            CDS       T00015                                 

Gene name
metK
Definition
(RefSeq) S-adenosylmethionine synthetase
  KO
K00789  
S-adenosylmethionine synthetase [EC:2.5.1.6]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rv1392 (metK)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Rv1392 (metK)
Enzymes [BR:mtu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.6  methionine adenosyltransferase
     Rv1392 (metK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
1566825..1568036
Genome map
AA seq 403 aa AA seqDB search
MSEKGRLFTSESVTEGHPDKICDAISDSVLDALLAADPRSRVAVETLVTTGQVHVVGEVT
TSAKEAFADITNTVRARILEIGYDSSDKGFDGATCGVNIGIGAQSPDIAQGVDTAHEARV
EGAADPLDSQGAGDQGLMFGYAINATPELMPLPIALAHRLSRRLTEVRKNGVLPYLRPDG
KTQVTIAYEDNVPVRLDTVVISTQHAADIDLEKTLDPDIREKVLNTVLDDLAHETLDAST
VRVLVNPTGKFVLGGPMGDAGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAMR
WVAKNVVAAGLAERVEVQVAYAIGKAAPVGLFVETFGTETEDPVKIEKAIGEVFDLRPGA
IIRDLNLLRPIYAPTAAYGHFGRTDVELPWEQLDKVDDLKRAI
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaaaagggtcggctgtttaccagtgagtcggtgacagagggacatcccgacaag
atctgtgacgccatcagcgactcggttctggacgcgcttctagcggcggacccgcgctca
cgtgtcgcggtcgagacgctggtgaccaccgggcaggtgcacgtggtgggtgaggtgacc
acctcggctaaggaggcgtttgccgacatcaccaacacggtccgcgcacggatcctcgag
atcggctacgactcgtcggacaagggtttcgacggggcgacctgcggggtgaacatcggc
atcggcgcacagtcacccgacatcgcccagggggtcgacaccgcccacgaggcccgggtc
gagggcgcggccgatccgctggactcccagggcgccggtgaccagggcctgatgttcggc
tacgcgatcaatgccaccccggaactgatgccactgcccatcgcgctggcccaccgactg
tcgcggcggctgaccgaggtccgcaagaacggggtgctgccctacctgcgtccggatggc
aagacgcaggtcactatcgcctacgaggacaacgttccggtgcggctggataccgtggtc
atctccacccagcacgcggccgatatcgacctggagaagacgcttgatcccgacatccgg
gaaaaggtgctcaacaccgtgctcgacgacctggcccacgaaaccctggacgcgtcgacg
gtgcgggtgctggtgaacccgaccggcaagttcgtgctcggcgggccgatgggcgatgcc
gggctcaccggccgcaagatcatcgtcgacacctacggcggctgggcccgccacggcggc
ggcgccttctccggcaaggatccgtccaaggtggaccggtcggcggcgtacgcgatgcgc
tgggtggccaagaatgtcgtcgccgccgggttggctgaacgggtcgaggtgcaggtggcc
tacgccatcggtaaagcggcacccgtcggcctgttcgtcgagacgttcggtaccgagacg
gaagacccggtcaagatcgagaaggccatcggcgaggtattcgacctgcgccccggtgcc
atcatccgcgacctgaacctgttgcgcccgatctatgcgccgaccgccgcctacgggcac
ttcggccgcaccgacgtcgaattaccgtgggagcagctcgacaaggtcgacgacctcaag
cgcgccatctag

DBGET integrated database retrieval system