KEGG   Mycobacterium tuberculosis H37Rv: Rv1408Help
Entry
Rv1408            CDS       T00015                                 

Gene name
rpe
Definition
(RefSeq) ribulose-phosphate 3-epimerase
  KO
K01783  
ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Pentose phosphate pathway
Pentose and glucuronate interconversions
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rv1408 (rpe)
   01230 Biosynthesis of amino acids
    Rv1408 (rpe)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rv1408 (rpe)
   00040 Pentose and glucuronate interconversions
    Rv1408 (rpe)
Enzymes [BR:mtu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     Rv1408 (rpe)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
1584499..1585197
Genome map
AA seq 232 aa AA seqDB search
MSLMAGSTGGPLIAPSILAADFARLADEAAAVNGADWLHVDVMDGHFVPNLTIGLPVVES
LLAVTDIPMDCHLMIDNPDRWAPPYAEAGAYNVTFHAEATDNPVGVARDIRAAGAKAGIS
VKPGTPLEPYLDILPHFDTLLVMSVEPGFGGQRFIPEVLSKVRAVRKMVDAGELTILVEI
DGGINDDTIEQAAEAGVDCFVAGSAVYGADDPAAAVAALRRQAGAASLHLSL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgctcatggccggtagcacggggggaccgctgatagcgccgtcgatcctagccgct
gatttcgccagactcgcggacgaagcggccgcggtcaacggcgccgactggttgcatgta
gacgtgatggacggtcacttcgtgccaaacctgaccatcggcctgccggtggtggagagc
ctgctggcggtcaccgacatcccgatggattgccatctaatgatcgacaacccggaccgg
tgggctccgccgtatgccgaggcgggcgcctacaacgtcaccttccacgcggaggccacc
gacaacccggtcggcgtggcccgcgatatccgggccgcgggggccaaagccgggatcagc
gtgaagccggggaccccgctggagccatacctggacatcctgccccatttcgacaccctg
ctcgtcatgtcggtagagcctggcttcggtggccagcggttcattcccgaggtgctgagc
aaggtgcgtgcggtgcgcaagatggtcgacgcgggcgagctgacgatcctggtcgagatc
gacggcggcatcaacgacgacacgattgagcaggctgccgaggccggcgtcgactgcttt
gtcgccggatcggcggtgtacggcgccgatgacccggccgcggcggttgcggcactacgg
cgacaggccggtgccgcctcactccacctgagcctatga

DBGET integrated database retrieval system