KEGG   Mycobacterium tuberculosis H37Rv: Rv1415Help
Entry
Rv1415            CDS       T00015                                 

Gene name
ribA2
Definition
(RefSeq) bifunctional riboflavin biosynthesis GTP cyclohydrolase II/3,4-dihydroxy-2-butanone 4-phosphate synthase
  KO
K14652  
3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Rv1415 (ribA2)
Enzymes [BR:mtu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     Rv1415 (ribA2)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     Rv1415 (ribA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
1590397..1591674
Genome map
AA seq 425 aa AA seqDB search
MTRLDSVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYTSGYLCVP
LDGAICDRLGLLPMYAVNQDKHGTAYTVTVDARNGIGTGISASDRATTMRLLADPTSVAD
DFTRPGHVVPLRAKDGGVLRRPGHTEAAVDLARMAGLQPAGAICEIVSQKDEGSMAHTDE
LRVFADEHGLALITIADLIEWRRKHEKHIERVAEARIPTRHGEFRAIGYTSIYEDVEHVA
LVRGEIAGPNADGDDVLVRVHSECLTGDVFGSRRCDCGPQLDAALAMVAREGRGVVLYMR
GHEGRGIGLMHKLQAYQLQDAGADTVDANLKLGLPADARDYGIGAQILVDLGVRSMRLLT
NNPAKRVGLDGYGLHIIERVPLPVRANAENIRYLMTKRDKLGHDLAGLDDFHESVHLPGE
FGGAL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacgaggttggactccgtcgagcgggcggttgccgacattgcggcgggtaaggccgtc
atcgtcatcgacgacgaagaccgggagaacgagggtgacctgatcttcgccgccgagaag
gcaacgccggagatggtggccttcatggtccgctacacctccggatacctgtgcgttccg
ctggacggtgccatctgcgaccggctgggcctgttgcccatgtacgcggtgaaccaggac
aagcacgggacggcatacaccgtcacagtcgatgcacggaatggcattggaactggcatt
tcggcgtccgatcgggctaccaccatgcggttgctggccgatccgaccagtgtggccgac
gatttcacccgccccggtcacgtggtccccttgcgggccaaggatggtggggttctgcgc
cggcccggccacaccgaggccgccgtggacctggcccggatggccgggctgcaacccgcg
ggggcgatttgcgagatcgtcagccaaaaagatgagggctcgatggcgcacaccgatgaa
ttgcgggtgttcgccgatgagcacggtctggcgctgatcaccattgctgacttgatcgaa
tggcggcgcaagcacgagaagcacattgagcgggtcgccgaggcgcggattccgactcgt
catggggagtttcgcgccatcggctacaccagcatctacgaggacgtggaacatgtcgcg
ctggtccgcggcgagatcgccgggcccaacgccgacggtgacgacgtgctggtccgggtg
cattcggagtgcttgaccggcgatgtgtttgggtcacgccgctgcgattgcgggcctcag
ctggacgccgcgctggcgatggtcgcccgtgaggggcgcggcgtggtgctgtacatgcgt
ggccacgagggccgcggcatcggcctgatgcacaaactgcaggcctaccaactgcaggac
gccggtgccgacaccgttgacgccaatctcaagcttggactacctgccgacgcaagggat
tacgggatcggcgcacagatcctggtcgatcttggggtacgttcgatgaggctgctgacc
aacaacccggccaagcgggtgggactggatggatacggattgcacatcatcgagcgcgtg
ccgctgccggtgcgggccaacgcggagaacatccgttacctgatgaccaagcgtgacaaa
ttggggcacgacttggctgggttggacgattttcacgaatccgtgcatctgcccggagaa
ttcggcggtgccttgtga

DBGET integrated database retrieval system