KEGG   Mycobacterium tuberculosis H37Rv: Rv1416Help
Entry
Rv1416            CDS       T00015                                 

Gene name
ribH
Definition
(RefSeq) 6,7-dimethyl-8-ribityllumazine synthase
  KO
K00794  
6,7-dimethyl-8-ribityllumazine synthase [EC:2.5.1.78]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Rv1416 (ribH)
Enzymes [BR:mtu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.78  6,7-dimethyl-8-ribityllumazine synthase
     Rv1416 (ribH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
1591671..1592153
Genome map
AA seq 160 aa AA seqDB search
MKGGAGVPDLPSLDASGVRLAIVASSWHGKICDALLDGARKVAAGCGLDDPTVVRVLGAI
EIPVVAQELARNHDAVVALGVVIRGQTPHFDYVCDAVTQGLTRVSLDSSTPIANGVLTTN
TEEQALDRAGLPTSAEDKGAQATVAALATALTLRELRAHS
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
gtgaagggtggcgccggggtgccggatctgccgtcgctggatgcgtctggtgtgcggctg
gcgattgtcgccagcagctggcacggaaagatctgcgacgcgctgttggacggcgcccgc
aaggtggccgccgggtgtggcctcgatgacccgactgtggttcgggtgctcggcgcgatc
gagattccggtggtggcgcaggaattggcccgcaatcatgatgccgtcgtcgcacttggc
gtcgtgatccgcggtcagacaccacatttcgactacgtgtgcgatgcggtaacccaggga
ctgacccgggtatcgctggattcctcgacgccgatcgccaacggcgtgctgaccaccaac
accgaggagcaggcgctggatcgggcggggctaccgacgtcggccgaggacaagggcgcc
caggcgactgtggcagccctggccaccgcgttgaccctgcgcgagctgcgcgctcactcg
tga

DBGET integrated database retrieval system