KEGG   Mycobacterium tuberculosis H37Rv: Rv1436Help
Entry
Rv1436            CDS       T00015                                 

Gene name
gap
Definition
(RefSeq) glyceraldehyde 3-phosphate dehydrogenase
  KO
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv1436 (gap)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     Rv1436 (gap)
Membrane trafficking [BR:mtu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Rv1436 (gap)
Exosome [BR:mtu04147]
 Exosomal proteins
  Proteins found in most exosomes
   Rv1436 (gap)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
1613307..1614326
Genome map
AA seq 339 aa AA seqDB search
MTVRVGINGFGRIGRNFYRALLAQQEQGTADVEVVAANDITDNSTLAHLLKFDSILGRLP
CDVGLEGDDTIVVGRAKIKALAVREGPAALPWGDLGVDVVVESTGLFTNAAKAKGHLDAG
AKKVIISAPATDEDITIVLGVNDDKYDGSQNIISNASCTTNCLAPLAKVLDDEFGIVKGL
MTTIHAYTQDQNLQDGPHKDLRRARAAALNIVPTSTGAAKAIGLVMPQLKGKLDGYALRV
PIPTGSVTDLTVDLSTRASVDEINAAFKAAAEGRLKGILKYYDAPIVSSDIVTDPHSSIF
DSGLTKVIDDQAKVVSWYDNEWGYSNRLVDLVTLVGKSL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgacggtccgagtaggcatcaacgggtttggtcgaatcggacgcaacttctaccgggcc
ttactggcccaacaggagcagggcaccgccgacgtggaggtggtcgccgccaacgacatc
accgacaacagcacgctggcgcatctgctcaaattcgactcgattctgggccggctgcct
tgcgatgtcggcctcgaaggcgacgacaccatcgtcgtcggccgcgcgaaaatcaaggcg
ctcgcggtccgggaggggccggcggcattgccatggggagacctcggcgtcgacgtcgtc
gtcgaatccaccggcctgttcaccaatgcggccaaagccaaaggccacctggacgccggc
gccaagaaggtgatcatctctgcgcccgccaccgacgaggacatcaccatcgtcctggga
gttaacgacgacaagtatgacggcagccagaacatcatctccaatgcgtcgtgcaccacg
aactgccttgcgccgctggccaaagtgctcgacgatgagttcggcatcgtcaagggcctg
atgaccaccatccacgcctacactcaggatcagaacctgcaggacgggccgcacaaggac
ctgcgtcgcgcccgcgccgccgcgctgaacatcgtgccgacctccaccggcgcggccaag
gccatcggcctggtgatgccgcagctaaagggcaagctcgacggttatgcgctgcgggtg
ccgatccccaccggctcggtcaccgaccttacggtcgacttatccacacgggccagtgtc
gatgagatcaacgcggcgttcaaagccgcggccgaaggcaggctcaagggcattctgaag
tactacgacgcgccgatcgtctcgagcgacatcgtcaccgacccgcacagttcgattttc
gactctgggttgaccaaagtcatcgacgaccaggccaaggtggtgtcgtggtacgacaac
gagtggggctactccaaccgcctggttgatctggtcacgctggtcggcaagtcgctctag

DBGET integrated database retrieval system