KEGG   Mycobacterium tuberculosis H37Rv: Rv1445cHelp
Entry
Rv1445c           CDS       T00015                                 

Gene name
devB
Definition
(RefSeq) 6-phosphogluconolactonase
  KO
K01057  
6-phosphogluconolactonase [EC:3.1.1.31]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rv1445c (devB)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rv1445c (devB)
Enzymes [BR:mtu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     Rv1445c (devB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1623714..1624457)
Genome map
AA seq 247 aa AA seqDB search
MSSSIEIFPDSDILVAAAGKRLVGAIGAAVAARGQALIVLTGGGNGIALLRYLSAQAQQI
EWSKVHLFWGDERYVPEDDDERNLKQARRALLNHVDIPSNQVHPMAASDGDFGGDLDAAA
LAYEQVLAASAAPGDPAPNFDVHLLGMGPEGHINSLFPHSPAVLESTRMVVAVDDSPKPP
PRRITLTLPAIQRSREVWLLVSGPGKADAVAAAIGGADPVSVPAAGAVGRQNTLWLLDRD
AAAKLPS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtagcatcgagatcttccccgatagcgacattctggtcgcggccgcgggtaag
cgcttggttggcgccatcggggccgcggtggcggccagagggcaggcgctgatcgtgctg
accgggggcggcaacgggattgcgcttctgcgctacctcagcgcccaagcacagcagatt
gaatggtccaaggtgcacctgttctggggcgacgaacgctacgttcccgaagacgatgac
gagcgcaatctcaagcaggcccggcgggcgttgctcaatcacgtcgacattccatcgaac
caggtgcacccgatggccgccagtgatggtgacttcggcggcgatctggacgccgcggcc
ctggcctacgaacaggtgctggccgccagtgccgcaccaggtgacccggcgccgaatttc
gacgtccacctgctgggcatggggcccgagggccacattaactcgctgttcccgcacagc
cccgccgtcctcgagagcacccgcatggtggtggcggtcgacgactcgccgaaaccgccg
ccacgccgaatcaccttgaccctgccggcgattcagcgttcccgcgaggtgtggctgctg
gtttccgggccgggtaaggccgacgccgtggccgcggccatcggcggcgccgatccggtt
tcggtaccggcggccggggccgtcgggcgtcagaacacgctctggctgctggaccgcgac
gccgccgccaagcttccgagttaa

DBGET integrated database retrieval system