KEGG   Mycobacterium tuberculosis H37Rv: Rv1447cHelp
Entry
Rv1447c           CDS       T00015                                 

Gene name
zwf2
Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  
glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Pentose phosphate pathway
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rv1447c (zwf2)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rv1447c (zwf2)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Rv1447c (zwf2)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Rv1447c (zwf2)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Rv1447c (zwf2)
Exosome [BR:mtu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Rv1447c (zwf2)
  Exosomal proteins of colorectal cancer cells
   Rv1447c (zwf2)
  Exosomal proteins of bladder cancer cells
   Rv1447c (zwf2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(1625418..1626962)
Genome map
AA seq 514 aa AA seqDB search
MKPAHAAASWRNPLRDKRDKRLPRIAGPCGMVIFGVTGDLARKKVMPAVYDLANRGLLPP
TFSLVGFARRDWSTQDFGQVVYNAVQEHCRTPFRQQNWDRLAEGFRFVPGTFDDDDAFAQ
LAETLEKLDAERGTGGNHAFYLAIPPKSFPVVCEQLHKSGLARPQGDRWSRVVIEKPFGH
DLASARELNKAVNAVFPEEAVFRIDHYLGKETVQNILALRFANQLFDPIWNAHYVDHVQI
TMAEDIGLGGRAGYYDGIGAARDVIQNHLMQLLALTAMEEPVSFHPAALQAEKIKVLSAT
RLAEPLDQTTSRGQYAAGWQGGEKVVGLLDEEGFAEDSTTETFAAITLEVDTRRWAGVPF
YLRTGKRLGRRVTEIALVFRRAPHLPFDATMTDELGTNAMVIRVQPDEGVTLRFGSKVPG
TAMEVRDVNMDFSYGSAFAEDSPEAYERLILDVLLGEPSLFPVNAEVELAWEILDPALEH
WAAHGTPDAYEAGTWGPESSLEMLRRTGREWRRP
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccggcccacgccgcggcgtcgtggcgcaacccgctacgagacaagcgggacaag
cgattacccagaatcgccggcccgtgcggcatggtgattttcggcgtcaccggcgacctg
gcccgcaagaaggtgatgccggccgtctacgatttggccaaccgcggcctgctgccgccc
acattctcgctggtggggtttgcccgccgagactggagcacccaggatttcggtcaagtg
gtgtacaacgccgtccaagagcactgccgaacaccgtttcggcaacagaactgggaccgg
ctggccgagggattccgttttgtgccaggcactttcgacgacgacgacgcgttcgcccaa
ctcgccgagacgctggagaagctcgacgccgagcgcggcaccggcggcaaccacgccttc
tacctggcgatcccgcccaaatccttcccggtggtgtgtgagcagctgcacaagtccggc
ctggcccgcccgcaaggcgaccggtggagccgagtcgtgatagagaagccgttcggccac
gacctggccagcgcacgcgagctgaacaaggcggtcaacgcggtcttcccggaggaagcg
gtcttccgcatcgaccactacctgggcaaagagacggtgcagaacatcctggcgctgcgg
ttcgccaaccagctgttcgacccgatctggaatgcgcactacgtcgaccacgtacagatc
accatggccgaagacatcggcctgggcgggcgcgcgggctattacgacggcatcggcgcg
gcccgcgatgtcatccagaaccatctcatgcagctgctggcgctgaccgcgatggaggag
ccggtcagcttccacccggcagcgttgcaggccgagaagatcaaggtgctctcggccacc
cgccttgccgagccactcgaccagaccaccagccgcggccagtacgccgccggctggcaa
ggcggggagaaggtggttgggctgctcgacgaggaggggttcgccgaggactccaccacc
gaaaccttcgccgctatcaccctggaagtcgatacgcgccggtgggccggcgtgccgttc
tatctgcgaacgggaaaacgattgggccgccgggtgaccgagatcgctctggtcttcagg
cgggcgccgcatctgccgttcgacgccaccatgaccgacgagctgggcaccaacgcgatg
gtcatccgcgtgcagcccgacgaaggtgtcacattgcggttcggctccaaggtgccgggc
accgccatggaagtccgcgacgtcaacatggacttctcctacggctcggcattcgccgaa
gattcaccggaggcctacgagcggctcatcctcgacgtcctgctcggcgagccctcgctg
tttccggtcaacgcggaggtcgaactggcgtgggagatcctcgatccagcgttggaacat
tgggcggcacacgggacgcccgacgcctacgaggcaggtacctggggtccggaatcatcc
ttggagatgctgcgccgcaccggccgggaatggcggcggccatag

DBGET integrated database retrieval system