KEGG   Mycobacterium tuberculosis H37Rv: Rv1448cHelp
Entry
Rv1448c           CDS       T00015                                 

Gene name
tal
Definition
(RefSeq) transaldolase
  KO
K00616  
transaldolase [EC:2.2.1.2]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rv1448c (tal)
   01230 Biosynthesis of amino acids
    Rv1448c (tal)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rv1448c (tal)
Enzymes [BR:mtu01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     Rv1448c (tal)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(1626959..1628080)
Genome map
AA seq 373 aa AA seqDB search
MTAQNPNLAALSAAGVSVWLDDLSRDRLRSGNLQELIDTKSVVGVTTNPSIFQKALSEGH
TYDAQIAELAARGADVDATIRTVTTDDVRSACDVLVPQWEDSDGVDGRVSIEVDPRLAHE
TEKTIQQAIELWKIVDRPNLFIKIPATKAGLPAISAVLAEGISVNVTLIFSVQRYREVMD
AYLTGMEKARQAGHSLSKIHSVASFFVSRVDTEIDKRLDRIGSRQALELRGQAGVANARL
AYATYREVFEDSDRYRSLKVDGARVQRPLWASTGVKNPDYSDTLYVTELVAPHTVNTMPE
KTIDAVADHGVIQGDTVTGTASDAQAVFDQLGAIGIDLTDVFAVLEEEGVRKFEASWNEL
LQETRAHLDTAAQ
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctcagaaccccaacctggccgcattgagcgccgcgggggtatcggtgtggctg
gatgacctgtcgcgggaccggctgcgctcgggcaatctgcaggagctgatcgacaccaag
agcgtcgtcggggtgaccaccaacccgtcgatctttcagaaggcgctgtcggagggccac
acctacgacgcccagatcgccgagctggccgcgcgcggcgccgacgtggatgccaccatc
cgcaccgtcaccactgacgacgtgcgcagcgcgtgcgacgtgctggtcccccagtgggag
gactccgacggggtcgacggccgggtgtcgatcgaggtcgacccgcggctggcacacgaa
accgaaaaaacgatccaacaggcaatcgagctgtggaagatcgtcgaccggccgaacctt
ttcatcaagatcccggccactaaggccggtctgcccgccatcagtgccgttctggcggaa
gggatttcggtcaacgttacgctgatcttctccgtgcagcggtaccgcgaggtgatggac
gcctacctgaccgggatggaaaaggcccggcaagccggacacagcctgtccaagatccat
tcggtggcatcgtttttcgtctcccgggtggacaccgaaatcgacaagcggctggacaga
atcggctcgcggcaagcgctcgaactgcgcggccaggccggtgtcgccaatgcccgcctg
gcctatgccacctaccgggaggtcttcgaagacagcgatcgttatcggtccctcaaggtc
gacggcgcccgggtccagcgcccgttgtgggcttccaccggcgtgaagaaccccgattac
tcggacaccctctacgtcaccgagttggtcgccccacacaccgtgaacactatgccggaa
aagacaattgacgccgtcgctgatcatggcgtgatccaaggcgacacggtcaccggaact
gcatccgatgcccaggcggtgttcgaccagctgggggcgatcggcatcgacctcaccgac
gtgtttgccgtcctcgaggaggaaggcgtgcggaagttcgaggcctcctggaacgagcta
ctccaggaaacccgggcgcatctcgacaccgctgcccaatga

DBGET integrated database retrieval system