KEGG   Mycobacterium tuberculosis H37Rv: Rv1449cHelp
Entry
Rv1449c           CDS       T00015                                 

Gene name
tkt
Definition
(RefSeq) transketolase
  KO
K00615  
transketolase [EC:2.2.1.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rv1449c (tkt)
   01230 Biosynthesis of amino acids
    Rv1449c (tkt)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rv1449c (tkt)
  Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    Rv1449c (tkt)
Enzymes [BR:mtu01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     Rv1449c (tkt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1628097..1630199)
Genome map
AA seq 700 aa AA seqDB search
MTTLEEISALTRPRHPDYWTEIDSAAVDTIRVLAADAVQKVGNGHPGTAMSLAPLAYTLF
QRTMRHDPSDTHWLGRDRFVLSAGHSSLTLYIQLYLGGFGLELSDIESLRTWGSKTPGHP
EFRHTPGVEITTGPLGQGLASAVGMAMASRYERGLFDPDAEPGASPFDHYIYVIASDGDI
EEGVTSEASSLAAVQQLGNLIVFYDRNQISIEDDTNIALCEDTAARYRAYGWHVQEVEGG
ENVVGIEEAIANAQAVTDRPSFIALRTVIGYPAPNLMDTGKAHGAALGDDEVAAVKKIVG
FDPDKTFQVREDVLTHTRGLVARGKQAHERWQLEFDAWARREPERKALLDRLLAQKLPDG
WDADLPHWEPGSKALATRAASGAVLSALGPKLPELWGGSADLAGSNNTTIKGADSFGPPS
ISTKEYTAHWYGRTLHFGVREHAMGAILSGIVLHGPTRAYGGTFLQFSDYMRPAVRLAAL
MDIDTIYVWTHDSIGLGEDGPTHQPIEHLSALRAIPRLSVVRPADANETAYAWRTILARR
NGSGPVGLILTRQGVPVLDGTDAEGVARGGYVLSDAGGLQPGEEPDVILIATGSEVQLAV
AAQTLLADNDILARVVSMPCLEWFEAQPYEYRDAVLPPTVSARVAVEAGVAQCWHQLVGD
TGEIVSIEHYGESADHKTLFREYGFTAEAVAAAAERALDN
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacactcgaagagatctccgcgcttacccgaccgcgccatcccgactactggacc
gagatcgattcggctgccgtcgacaccatccgggtattggccgccgatgccgtccaaaag
gtcggcaacggtcatcctggaacggcgatgagcctggctccgttggcctacacgctgttt
cagcggacaatgcgtcacgatcccagcgacacacactggctgggccgcgatcggttcgtt
ttgtcggccgggcacagcagcctgaccctctacatccagctctacctcggcggcttcggc
ctggaactgtccgacattgagtcgttgcgcacctggggatccaagacccccggacacccg
gagttccgccacacccccggcgttgagatcaccaccggcccgctggggcagggactggcg
tcggcggtcgggatggcgatggcctcgcgctacgagcgcggcctgttcgacccggacgcc
gaaccgggcgccagccccttcgaccactacatctatgtcatcgcctccgacggtgacatc
gaagaaggggtgacctcggaggcgtcgtcgctggccgcggtccagcaactgggcaacctc
atcgtgttctacgaccgcaaccagatctcgatcgaggacgacaccaacatcgcgctgtgt
gaggacaccgcggcccgctaccgcgcgtacggctggcacgtgcaagaggttgagggcggt
gagaacgtcgtcggcatcgaggaggccatcgccaatgcgcaggcggtcaccgaccggccc
tcgttcatcgcgctgcgcaccgtcatcggctatccggcgccgaacctgatggacaccggc
aaggcgcacggcgcggcgctgggcgacgacgaggtggccgcagtcaagaagatcgtcggc
ttcgatccggacaagacgttccaggtccgcgaggacgtcctcacccacacccgagggctg
gtggcccgcggcaaacaggcccacgaacgctggcagctcgaattcgatgcctgggcgcgg
cgtgaacccgagcgcaaggcgctgctggaccggctgctcgcgcagaagttgcccgacggc
tgggacgccgacttgccccactgggaaccggggtccaaggcgctggccacccgtgcggcc
tcgggtgcggtgctgtccgcgctcgggccgaaactgcccgagttgtggggcggttcggcc
gacctggcgggcagcaacaacacaacgataaagggcgccgactcctttggcccgccctcg
atttccaccaaggagtacaccgcgcactggtatggtcgcaccttgcacttcggtgttcgc
gagcacgcgatgggtgccatcctgtccggcatcgtgctgcacggacccacccgggcttac
ggcggcaccttcctgcagttctccgactacatgcgcccggcggtgcggctggcggcgttg
atggacatcgacaccatctacgtctggacgcacgactcgatcggcctcggcgaagacggg
cccacccatcaaccgatcgagcacctctcggcgctgcgcgcgatcccccggctgtcggtg
gtgcgcccggcagatgccaacgagacagcctacgcctggcgcacgatcctggcccgccgc
aacggcagcgggccggtcgggttgatcctgacccgccagggtgtgccggtgctggacggc
accgacgccgagggggttgcccgcggcggttacgtgctgagtgacgccggtggtctgcaa
ccgggcgaggaacccgacgtcattctcatcgccaccggctcggaggtgcagctggcggtc
gcggcgcagacgttgctggcggacaacgacatcctcgctcgggtggtgtcgatgccgtgc
ctggagtggttcgaggcccaaccctacgagtaccgcgacgcggtgctgcccccgacggtg
tcggcgcgggtggccgtcgaagccggcgtcgcgcaatgctggcaccagctggttggcgac
acgggcgagatcgtctcgatcgagcactacggcgaatccgcggaccacaagaccttgttc
cgcgagtacggcttcactgccgaggccgtggccgccgccgccgaacgagcgctggataac
tga

DBGET integrated database retrieval system