KEGG   Mycobacterium tuberculosis H37Rv: Rv1464Help
Entry
Rv1464            CDS       T00015                                 

Gene name
csd
Definition
(RefSeq) cysteine desulfurase
  KO
K11717  
cysteine desulfurase / selenocysteine lyase [EC:2.8.1.7 4.4.1.16]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Selenocompound metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    Rv1464 (csd)
Enzymes [BR:mtu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     Rv1464 (csd)
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.16  selenocysteine lyase
     Rv1464 (csd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
1651518..1652771
Genome map
AA seq 417 aa AA seqDB search
MTASVNSLDLAAIRADFPILKRIMRGGNPLAYLDSGATSQRPLQVLDAEREFLTASNGAV
HRGAHQLMEEATDAYEQGRADIALFVGADTDELVFTKNATEALNLVSYVLGDSRFERAVG
PGDVIVTTELEHHANLIPWQELARRTGATLRWYGVTDDGRIDLDSLYLDDRVKVVAFTHH
SNVTGVLTPVSELVSRAHQSGALTVLDACQSVPHQPVDLHELGVDFAAFSGHKMLGPNGI
GVLYGRRELLAQMPPFLTGGSMIETVTMEGATYAPAPQRFEAGTPMTSQVVGLAAAARYL
GAIGMAAVEAHERELVAAAIEGLSGIDGVRILGPTSMRDRGSPVAFVVEGVHAHDVGQVL
DDGGVAVRVGHHCALPLHRRFGLAATARASFAVYNTADEVDRLVAGVRRSRHFFGRA
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgacggcctcggtgaactcgctcgatctggcggcgattcgcgccgatttccccatcctc
aagcgcatcatgcggggtggaaacccgttggcgtatttggactccggcgccacctcacaa
cgcccgctgcaggtcctcgacgccgagcgcgagttcctgaccgcgtccaacggcgcggtc
catcgtggcgcgcaccagctgatggaggaggcgaccgacgcctacgagcagggccgcgcg
gacatcgcgttattcgtcggcgccgacacggacgagctggtgttcaccaaaaatgccacc
gaggcgctcaacctggtgtcatatgtgctgggggacagccgtttcgagcgtgccgtcggc
cccggcgacgtgatcgtcaccaccgagctggagcatcacgccaacctgatcccgtggcag
gagctggcccggcgcaccggggccacattgcgctggtacggggtgactgacgacgggcgc
atcgacctggactcgctgtatctggacgaccgtgtcaaagtcgttgcgttcacccatcat
tccaatgtgaccggggtgctgacaccggtgagcgagctggtctcccgcgcccaccagtcg
ggtgcgctgaccgtgctggacgcctgccagtcggtgccgcaccagccggttgacctgcac
gaactcggcgtcgacttcgccgcgttttccggacataaaatgctgggccccaacggaatc
ggtgtgctgtacggccgccgtgagctgctagcgcagatgcccccatttctcaccggcggt
tcgatgatcgaaacggtgaccatggaaggcgccacctacgcgccggcgccgcaacggttc
gaggccggtaccccgatgacctcccaggtggtcgggttggccgccgcggcccgctatctc
ggcgcgatcggcatggccgcggtggaggcccacgagcgggagctggtagccgcggccatc
gaaggcctgtccggcatcgacggtgtgcggatccttggcccgacgtcgatgcgggaccga
gggtcgccggtggcgttcgtcgtcgagggcgtgcacgcgcacgacgtgggtcaggtactc
gacgacggcggcgtggcggtgcgggtcgggcaccactgcgcgctgccgctgcaccgcagg
ttcggtctggccgccaccgcgcgggcgtcgttcgcggtgtacaacaccgcagacgaggtg
gaccgcttggtggccggcgtgcggcgatcccggcatttctttggaagagcgtga

DBGET integrated database retrieval system