KEGG   Mycobacterium tuberculosis H37Rv: Rv1483Help
Entry
Rv1483            CDS       T00015                                 

Gene name
fabG1
Definition
(RefSeq) 3-oxoacyl-ACP reductase FabG
  KO
K11610  
beta-ketoacyl ACP reductase [EC:1.1.1.100]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     Rv1483 (fabG1)
Lipid biosynthesis proteins [BR:mtu01004]
 Fatty acid synthase
  Component type
   Rv1483 (fabG1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
1673440..1674183
Genome map
AA seq 247 aa AA seqDB search
MTATATEGAKPPFVSRSVLVTGGNRGIGLAIAQRLAADGHKVAVTHRGSGAPKGLFGVEC
DVTDSDAVDRAFTAVEEHQGPVEVLVSNAGLSADAFLMRMTEEKFEKVINANLTGAFRVA
QRASRSMQRNKFGRMIFIGSVSGSWGIGNQANYAASKAGVIGMARSIARELSKANVTANV
VAPGYIDTDMTRALDERIQQGALQFIPAKRVGTPAEVAGVVSFLASEDASYISGAVIPVD
GGMGMGH
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
gtgactgccacagccactgaaggggccaaacccccattcgtatcccgttcagtcctggtt
accggaggaaaccgggggatcgggctggcgatcgcacagcggctggctgccgacggccac
aaggtggccgtcacccaccgtggatccggagcgccaaaggggctgtttggcgtcgaatgt
gacgtcaccgacagcgacgccgtcgatcgcgccttcacggcggtagaagagcaccagggt
ccggtcgaggtgctggtgtccaacgccggcctatccgcggacgcattcctcatgcggatg
accgaggaaaagttcgagaaggtcatcaacgccaacctcaccggggcgttccgggtggct
caacgggcatcgcgcagcatgcagcgcaacaaattcggtcgaatgatattcataggttcg
gtctccggcagctggggcatcggcaaccaggccaactacgcagcctccaaggccggagtg
attggcatggcccgctcgatcgcccgcgagctgtcgaaggcaaacgtgaccgcgaatgtg
gtggccccgggctacatcgacaccgatatgacccgcgcgctggatgagcggattcagcag
ggggcgctgcaatttatcccagcgaagcgggtcggcacccccgccgaggtcgccggggtg
gtcagcttcctggcttccgaggatgcgagctatatctccggtgcggtcatcccggtcgac
ggcggcatgggtatgggccactga

DBGET integrated database retrieval system