KEGG   Mycobacterium tuberculosis H37Rv: Rv1485Help
Entry
Rv1485            CDS       T00015                                 

Gene name
hemZ
Definition
(RefSeq) ferrochelatase
  KO
K01772  
protoporphyrin/coproporphyrin ferrochelatase [EC:4.99.1.1 4.99.1.9]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rv1485 (hemZ)
Enzymes [BR:mtu01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.1  protoporphyrin ferrochelatase
     Rv1485 (hemZ)
    4.99.1.9  coproporphyrin ferrochelatase
     Rv1485 (hemZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
1675017..1676051
Genome map
AA seq 344 aa AA seqDB search
MQFDAVLLLSFGGPEGPEQVRPFLENVTRGRGVPAERLDAVAEHYLHFGGVSPINGINRT
LIAELEAQQELPVYFGNRNWEPYVEDAVTAMRDNGVRRAAVFATSAWSGYSSCTQYVEDI
ARARRAAGRDAPELVKLRPYFDHPLFVEMFADAITAAAATVRGDARLVFTAHSIPTAADR
RCGPNLYSRQVAYATRLVAAAAGYCDFDLAWQSRSGPPQVPWLEPDVTDQLTGLAGAGIN
AVIVCPIGFVADHIEVVWDLDHELRLQAEAAGIAYARASTPNADPRFARLARGLIDELRY
GRIPARVSGPDPVPGCLSSINGQPCRPPHCVASVSPARPSAGSP
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttgatgccgtcctgctgctgtcgttcggcggaccggaagggcccgagcaggtg
cggccgttcctggagaacgttacccggggccgcggtgtgcctgccgaacggttggacgcg
gtggccgagcactacctgcatttcggtggggtatcaccgatcaatggcattaatcgcaca
ctgatcgcggagctggaggcgcagcaagaactgccggtgtacttcggtaaccgcaactgg
gagccgtatgtagaagatgccgttacggccatgcgcgacaacggtgtccggcgtgcagcg
gtctttgcgacatctgcgtggagcggttactcgagctgcacacagtacgtggaggacatc
gcgcgggcccgccgcgcggccgggcgcgacgcgcctgaactggtaaaactgcggccctac
ttcgaccatccgctgttcgtcgagatgttcgccgacgccatcaccgcggccgccgcaacc
gtgcgcggtgatgcccggctggtgttcaccgcgcattcgatcccgacggccgccgaccgc
cgctgtggccccaacctctacagccgccaagtcgcctacgccacaaggctggtcgcggcc
gctgccggatactgcgactttgacctggcctggcagtcgagatcgggcccgccgcaggtg
ccctggctggagccagacgttaccgaccagctcaccggtctggctggggccggcatcaac
gcggtgatcgtgtgtcccattggattcgtcgccgaccatatcgaggtggtgtgggatctc
gaccacgagttgcgattacaagccgaggcagcgggcatcgcgtacgcccgggccagcacc
cccaatgccgacccgcggttcgctcgactagccagaggtttgatcgacgaactccgttac
ggccgtatacctgcgcgggtgagtggccccgatccggtgccgggctgtctgtccagcatc
aacggccagccatgccgtccgccgcactgcgtggctagcgtcagtccggccaggccgagt
gcaggatcgccgtga

DBGET integrated database retrieval system