KEGG   Mycobacterium tuberculosis H37Rv: Rv1492Help
Entry
Rv1492            CDS       T00015                                 

Gene name
mutA
Definition
(RefSeq) methylmalonyl-CoA mutase small subunit
  KO
K01847  
methylmalonyl-CoA mutase [EC:5.4.99.2]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Valine, leucine and isoleucine degradation
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rv1492 (mutA)
   00640 Propanoate metabolism
    Rv1492 (mutA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rv1492 (mutA)
Enzymes [BR:mtu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.2  methylmalonyl-CoA mutase
     Rv1492 (mutA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
1682157..1684004
Genome map
AA seq 615 aa AA seqDB search
MSIDVPERADLEQVRGRWRNAVAGVLSKSNRTDSAQLGDHPERLLDTQTADGFAIRALYT
AFDELPEPPLPGQWPFVRGGDPLRDVHSGWKVAEAFPANGATADTNAAVLAALGEGVSAL
LIRVGESGVAPDRLTALLSGVYLNLAPVILDAGADYRPACDVMLALVAQLDPGQRDTLSI
DLGADPLTASLRDRPAPPIEEVVAVASRAAGERGLRAITVDGPAFHNLGATAATELAATV
AAAVAYLRVLTESGLVVSDALRQISFRLAADDDQFMTLAKMRALRQLWARVAEVVGDPGG
GAAVVHAETSLPMMTQRDPWVNMLRCTLAAFGAGVGGADTVLVHPFDVAIPGGFPGTAAG
FARRIARNTQLLLLEESHVGRVLDPAGGSWFVEELTDRLARRAWQRFQAIEARGGFVEAH
DFLAGQIAECAARRADDIAHRRLAITGVNEYPNLGEPALPPGDPTSPVRRYAAGFEALRD
RSDHHLARTGARPRVLLLPLGPLAEHNIRTTFATNLLASGGIEAIDPGTVDAGTVGNAVA
DAGSPSVAVICGTDARYRDEVADIVQAARAAGVSRVYLAGPEKALGDAAHRPDEFLTAKI
NVVQALSNLLTRLGA
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
gtgtccattgatgtacccgagcgtgccgacctagaacaggttcgcgggcgctggcgcaac
gcggttgccggtgtgctgtccaagagcaaccgtaccgactcagcacaactcggcgatcac
cccgagcggctgctggatacccagaccgctgacgggttcgccatccgggccctctacacc
gcgttcgacgagctcccggagccgccgttgccgggccagtggccctttgtgcgcggcgga
gacccgctgcgcgacgtgcattccggctggaaggtcgccgaggcgtttcccgccaacggt
gcgacggccgacaccaacgcggcggtgctggccgcgctcggcgagggggtcagcgcgctg
ctgatccgggtgggggagtcgggtgtggcgcctgaccggctcacggcgctgctgtccggg
gtgtatctgaacctggcgccggtcatcctcgacgccggcgccgactaccgcccggcctgc
gacgtcatgctggcgctggtcgcccagctcgatcccggccagcgcgacaccctgtcgatc
gacctgggcgccgacccgctgacggcgtcgctgcgcgatcgtcccgccccgccgatcgag
gaggtcgtcgcggtcgcatcccgggcggccggcgaacgtgggcttcgtgcgatcaccgtc
gacggaccggccttccacaacctgggcgcgaccgcggccaccgaactcgcggccaccgtc
gcggccgcggtggcctacctgcgggtgctcaccgaatccgggctcgtggtgagtgacgcg
ctgcggcagatcagcttccggctcgccgccgacgacgaccagttcatgacgctggccaag
atgcgggctctacgtcaactgtgggcgcgggtcgccgaggtcgtgggcgacccgggtggc
ggcgcggccgtcgtgcacgcggagacgtcgctaccgatgatgacccagcgtgatccgtgg
gtgaacatgctgcgctgcacgctggcggccttcggcgccggtgtcggtggcgcggacacc
gtgctggtgcacccgttcgacgtggcgattcccggcggctttcccggcacggcggccggc
tttgcgcgccggatcgctcgcaacacccaactgctgcttttagaagagtcgcatgtcggc
agggtgctcgatcccgccggcgggtcgtggttcgtcgaagagctcaccgaccggctggct
cggcgcgcctggcagcgtttccaggccatcgaggcccgtggcggcttcgtcgaggcccac
gacttcctggccggccagatcgccgagtgcgccgcccgccgcgccgacgacatcgcccat
cggcgcctggcgatcaccggcgtcaacgaatacccgaacctgggcgaacccgcgctgccg
cccggtgatccgacatcgccggtgcgccgctacgctgccggattcgaagcattgcgcgat
cgatccgatcaccacctagcccgcactggcgcacggccgcgggtgctgttgctgccgttg
ggtccgctggccgagcacaacatccggacgaccttcgccaccaacctgctggcgtccggc
ggcatcgaggcgatcgacccgggaacggttgatgcgggcaccgtcgggaatgccgttgcc
gatgccggttcgcccagcgttgccgtgatctgcggcaccgatgcgcgctaccgggacgag
gttgccgacattgtgcaagcggcccgagccgccggtgtttcgagggtgtacctcgcgggt
cccgagaaggcgttgggagatgccgcacaccggcccgacgagtttttgaccgcgaaaatc
aatgtggtgcaagccttgtcgaatctgctgacgcggttgggggcctag

DBGET integrated database retrieval system