KEGG   Mycobacterium tuberculosis H37Rv: Rv1500Help
Entry
Rv1500            CDS       T00015                                 

Definition
(RefSeq) glycosyltransferase
  KO
K13670  
putative glycosyltransferase [EC:2.4.-.-]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.-  Glycosyltransferases
    2.4.-.-  
     Rv1500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
1690850..1691878
Genome map
AA seq 342 aa AA seqDB search
MRLSIVTTMYMSEPYVLEFYRRARAAADKITPDVEIIFVDDGSPDAALQQAVSLLDSDPC
VRVIQLSRNFGHHKAMMTGLAHATGDLVFLIDSDLEEDPALLEPFYEKLISTGADVVFGC
HARRPGGWLRNFGPKIHYRASALLCDPPLHENTLTVRLMTADYVRSLVQHQERELSIAGL
WQITGFYQVPMSVNKAWKGTTTYTFRRKVATLVDNVTSFSNKPLVFIFYLGAAIFIISSS
AAGYLIIDRIFFRALQAGWASVIVSIWMLGGVTIFCIGLVGIYVSKVFIETKQRPYTIIR
RIYGSDLTTREPSSLKTAFPAAHLSNGKRVTSEPEGLATGNR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctctcgatcgtaacgactatgtacatgtcagagccttacgtgctggagttctac
aggagagcgcgcgcggcggcggacaaaatcacgcctgacgtcgagatcatcttcgtggat
gacggctcgccggacgcagcgctccagcaggccgtctcgctgctcgacagcgacccctgt
gttcgggtaattcagctttcgcgaaatttcggccaccacaaagcgatgatgaccggcctg
gcgcacgccacgggggatctcgtctttctgatcgactcagacttggaagaggacccggct
ctcctagagccgttctatgaaaagctgatctcgacgggcgccgacgtagtatttggttgc
cacgcgcggcggcccggcggttggttgaggaatttcggaccgaaaatccattatcgggcg
tccgccctgctgtgtgaccccccgcttcatgaaaatactctcaccgtgcggctgatgaca
gccgactatgtacgcagcttggtccagcaccaggagcgtgaactttcgattgccggtctg
tggcagattactggtttttaccaggtgcccatgtccgtaaacaaggcatggaaaggaacg
accacatacacgtttaggcgtaaagtagcgacactggtcgacaatgtcacttcatttagc
aacaaacctctagtcttcattttctatcttggtgcggccatttttattatttcaagctcg
gccgcgggctatctgatcatcgatcgaattttctttcgcgctctgcaagcggggtgggca
tccgtgatcgtatccatctggatgctggggggtgtgacgattttctgcatagggctggtc
ggaatttatgtatccaaagtcttcatcgaaactaagcagcggccatacacaattatccga
agaatctacggttcggatttaacaacccgggagccatcctctctgaagaccgccttcccg
gccgcgcacctgtcgaacgggaaacgcgtcacatcagagccagagggattggcaactggc
aacaggtga

DBGET integrated database retrieval system