KEGG   Mycobacterium tuberculosis H37Rv: Rv1559Help
Entry
Rv1559            CDS       T00015                                 

Gene name
ilvA
Definition
(RefSeq) threonine dehydratase IlvA
  KO
K01754  
threonine dehydratase [EC:4.3.1.19]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rv1559 (ilvA)
   01230 Biosynthesis of amino acids
    Rv1559 (ilvA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv1559 (ilvA)
   00290 Valine, leucine and isoleucine biosynthesis
    Rv1559 (ilvA)
Enzymes [BR:mtu01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     Rv1559 (ilvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
1763428..1764717
Genome map
AA seq 429 aa AA seqDB search
MSAELSQSPSSSPLFSLSGADIDRAAKRIAPVVTPTPLQPSDRLSAITGATVYLKREDLQ
TVRSYKLRGAYNLLVQLSDEELAAGVVCSSAGNHAQGFAYACRCLGVHGRVYVPAKTPKQ
KRDRIRYHGGEFIDLIVGGSTYDLAAAAALEDVERTGATLVPPFDDLRTIAGQGTIAVEV
LGQLEDEPDLVVVPVGGGGCIAGITTYLAERTTNTAVLGVEPAGAAAMMAALAAGEPVTL
DHVDQFVDGAAVNRAGTLTYAALAAAGDMVSLTTVDEGAVCTAMLDLYQNEGIIAEPAGA
LSVAGLLEADIEPGSTVVCLISGGNNDVSRYGEVLERSLVHLGLKHYFLVDFPQEPGALR
RFLDDVLGPNDDITLFEYVKRNNRETGEALVGIELGSAADLDGLLARMRATDIHVEALEP
GSPAYRYLL
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgccgaactgagccagagcccgagcagctcgccgctgttttcactatctggggca
gacatcgaccgtgccgccaagcggatcgcaccggtagtcacgcccaccccgttgcaacct
agcgatcggttgtcggcgatcactggcgccacggtctacctcaagcgcgaagacttgcag
acggtgcgctcttataagctacgcggagcgtacaacctgttggtgcagttgtccgatgag
gaactggccgcgggcgtggtgtgttcttctgcgggcaaccacgcgcagggcttcgcgtat
gcgtgtcgctgtctgggtgtgcacggccgggtctacgtacctgccaaaacccccaagcag
aagcgtgaccggatccgctaccacggcggggagttcatcgacctgatcgtgggtgggtcg
acctatgatctggctgcggcggcggcccttgaggacgtggaacgcaccggggccacgctg
gtaccgccgtttgacgacctgcgcaccatcgccggccagggcacgatagccgtcgaagtg
cttggccagctcgaggacgagccggacctggtggtggtcccggtgggtggcggcggctgc
atcgcggggatcaccacctacctggccgagcggacgaccaacaccgcggtgctgggcgtc
gagccggctggtgcggccgccatgatggccgcgctcgcggcgggcgagccggtgacgctg
gaccatgtcgaccagttcgtcgacggcgccgcggtgaaccgggcgggcacgctgacctat
gccgcgctagccgccgccggcgacatggtttcgctcaccaccgtcgacgagggtgcggtg
tgcacggcgatgctcgatctgtatcagaacgagggcatcatcgccgaaccggccggtgcc
ctgtcggtcgccggtctgttggaagccgacatcgagcccgggtccaccgtggtgtgcctg
atttcgggcggcaacaacgacgtgtcccgttacggggaggtgttggagcgctcgctggtc
cacctgggcctcaagcactatttcctggtcgacttcccgcaggagcccggtgcgctgcgc
cggtttctcgacgacgtgctcggacccaacgacgacatcaccttgttcgagtacgtcaag
cgcaacaaccgggagaccggtgaggcgctggtgggtatcgagctgggatcggccgcggat
ctagacggtctgctggcccggatgcgggcgaccgacattcacgtcgaggcgttggaaccg
gggtcgccggcttaccgctatctgctgtag

DBGET integrated database retrieval system