KEGG   Mycobacterium tuberculosis H37Rv: Rv1568Help
Entry
Rv1568            CDS       T00015                                 

Gene name
bioA
Definition
(RefSeq) adenosylmethionine--8-amino-7-oxononanoate aminotransferase BioA
  KO
K00833  
adenosylmethionine---8-amino-7-oxononanoate aminotransferase [EC:2.6.1.62]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Biotin metabolism
Metabolic pathways
Module
Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Rv1568 (bioA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.62  adenosylmethionine---8-amino-7-oxononanoate transaminase
     Rv1568 (bioA)
Amino acid related enzymes [BR:mtu01007]
 Aminotransferase (transaminase)
  Class III
   Rv1568 (bioA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
1775392..1776705
Genome map
AA seq 437 aa AA seqDB search
MAAATGGLTPEQIIAVDGAHLWHPYSSIGREAVSPVVAVAAHGAWLTLIRDGQPIEVLDA
MSSWWTAIHGHGHPALDQALTTQLRVMNHVMFGGLTHEPAARLAKLLVDITPAGLDTVFF
SDSGSVSVEVAAKMALQYWRGRGLPGKRRLMTWRGGYHGDTFLAMSICDPHGGMHSLWTD
VLAAQVFAPQVPRDYDPAYSAAFEAQLAQHAGELAAVVVEPVVQGAGGMRFHDPRYLHDL
RDICRRYEVLLIFDEIATGFGRTGALFAADHAGVSPDIMCVGKALTGGYLSLAATLCTAD
VAHTISAGAAGALMHGPTFMANPLACAVSVASVELLLGQDWRTRITELAAGLTAGLDTAR
ALPAVTDVRVCGAIGVIECDRPVDLAVATPAALDRGVWLRPFRNLVYAMPPYICTPAEIT
QITSAMVEVARLVGSLP
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggcgactggcgggttgacgcccgagcagatcatcgcggtcgatggcgcccat
ctgtggcacccttacagctccatcggcagggaagccgtgtcgccggtggtggccgtcgcc
gcccacggagcgtggttgacgctgattcgcgacggccagccgatcgaggtgctcgacgcg
atgagctcctggtggaccgcgatccacgggcacggccaccccgctctggaccaggcgtta
accacccagttgcgggtgatgaaccacgtcatgttcggggggctgactcacgagccggcg
gcccggctggcgaagctgctggtcgacatcaccccggcgggtctcgacacggtgttcttc
agcgactccggctcggtgtcggtggaagtcgcggccaagatggcgctgcagtactggcgc
ggccgcggcctgcccggcaagcgacggctcatgacctggcgcggcggctatcacggcgac
accttcctggctatgagcatctgcgacccgcacggcggcatgcactcgctgtggaccgac
gtcctggccgcccaagtgttcgcgccacaagtgccacgggactacgatcccgcctacagc
gcggcgttcgaggcgcagctggcgcagcacgccggcgagctggccgcggtggtcgtggag
ccggtcgtgcagggtgcgggcggtatgcgttttcacgacccgcgctatctgcacgacctg
cgggacatctgccgccgttacgaggtgctgctgatcttcgatgagatcgccaccggcttc
ggccgcaccggcgcgttgttcgccgccgaccacgccggggtgagcccggacatcatgtgt
gtcggcaaggcgctcaccggcggctacctcagcttggccgccaccttgtgcaccgccgac
gtcgcgcacaccatcagcgccggtgcggccggggcgctgatgcacggccccaccttcatg
gccaatccgctggcctgtgcggtctcggtggccagtgtggagctgctgctcggccaggac
tggcgcacgcgcatcaccgaactggccgccgggctgaccgccggcctggataccgcccgg
gcgctgcccgccgtcaccgatgtgcgggtgtgcggcgcgatcggcgtcatcgaatgcgac
cgaccggtcgacctggccgtcgcgactcccgcggcgctggatcgaggcgtgtggctgcgc
ccgtttcgcaacctggtctacgccatgccgccctatatctgcacaccggccgagatcacg
cagatcacctcggcgatggtcgaggtcgcacggctcgtaggctcactgccatga

DBGET integrated database retrieval system