KEGG   Mycobacterium tuberculosis H37Rv: Rv1589Help
Entry
Rv1589            CDS       T00015                                 

Gene name
bioB
Definition
(RefSeq) biotin synthetase
  KO
K01012  
biotin synthase [EC:2.8.1.6]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Biotin metabolism
Metabolic pathways
Module
Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Rv1589 (bioB)
Enzymes [BR:mtu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.6  biotin synthase
     Rv1589 (bioB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
1790284..1791333
Genome map
AA seq 349 aa AA seqDB search
MTQAATRPTNDAGQDGGNNSDILVVARQQVLQRGEGLNQDQVLAVLQLPDDRLEELLALA
HEVRMRWCGPEVEVEGIISLKTGGCPEDCHFCSQSGLFASPVRSAWLDIPSLVEAAKQTA
KSGATEFCIVAAVRGPDERLMAQVAAGIEAIRNEVEINIACSLGMLTAEQVDQLAARGVH
RYNHNLETARSFFANVVTTHTWEERWQTLSMVRDAGMEVCCGGILGMGETLQQRAEFAAE
LAELGPDEVPLNFLNPRPGTPFADLEVMPVGDALKAVAAFRLALPRTMLRFAGGREITLG
DLGAKRGILGGINAVIVGNYLTTLGRPAEADLELLDELQMPLKALNASL
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcaagcggcaacgcgaccgacgaacgacgccggccaggatggcgggaacaactcg
gacattctggtggttgcccgccaacaggtgctgcagcgcggtgagggcctgaaccaggac
caggtgctggcggtgctgcagctacccgacgaccggctcgaggagctgttggcgctggcc
cacgaggtgcggatgcgctggtgcggacccgaggtcgaggtcgaaggcatcatcagcctg
aaaaccggtggctgcccggaggattgccatttctgctcgcaatcggggctgttcgcctcc
ccggtgcgcagcgcctggctggacatacccagcctggtcgaggcggccaaacagaccgcc
aagtccggcgccaccgagttctgcatcgtggccgcggtgcgcggacccgacgagcgattg
atggcccaggtcgcggccggcatcgaggcgattcgcaacgaagtcgagatcaacatcgcc
tgctccctagggatgctgaccgccgagcaagtggaccaactggcggcgaggggggtgcat
cgctacaaccacaacctcgaaacggcgcgctcgttcttcgccaacgtcgtcaccacccac
acctgggaagagcgctggcagacgctatcgatggtgcgtgacgcgggcatggaggtttgc
tgcggcggcatcctcggcatgggggagacgctgcagcagcgcgcggaattcgccgccgag
cttgccgagctgggccccgacgaggtcccgctgaacttcctcaacccgcggcccggtacc
ccgttcgccgacctggaggtaatgccggtcggtgacgcgctcaaggcggtggccgccttc
cggttggcgttaccgcgcaccatgctgcggttcgccggtggccgcgagatcaccctgggt
gacctcggcgccaagcgaggcatcctgggcggcatcaacgccgtgatcgtcggcaactac
ctgaccaccctcggccggcccgcggaagccgacctggaactgctcgacgagctacagatg
ccgctgaaggcactcaacgccagcctgtaa

DBGET integrated database retrieval system