KEGG   Mycobacterium tuberculosis H37Rv: Rv1594Help
Entry
Rv1594            CDS       T00015                                 

Gene name
nadA
Definition
(RefSeq) quinolinate synthetase A
  KO
K03517  
quinolinate synthase [EC:2.5.1.72]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Module
NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Rv1594 (nadA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.72  quinolinate synthase
     Rv1594 (nadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
1794756..1795805
Genome map
AA seq 349 aa AA seqDB search
MTVLNRTDTLVDELTADITNTPLGYGGVDGDERWAAEIRRLAHLRGATVLAHNYQLPAIQ
DVADHVGDSLALSRVAAEAPEDTIVFCGVHFMAETAKILSPHKTVLIPDQRAGCSLADSI
TPDELRAWKDEHPGAVVVSYVNTTAAVKALTDICCTSSNAVDVVASIDPDREVLFCPDQF
LGAHVRRVTGRKNLHVWAGECHVHAGINGDELADQARAHPDAELFVHPECGCATSALYLA
GEGAFPAERVKILSTGGMLEAAHTTRARQVLVATEVGMLHQLRRAAPEVDFRAVNDRASC
KYMKMITPAALLRCLVEGADEVHVDPGIAASGRRSVQRMIEIGHPGGGE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgctgaatcgcacggacacgctcgtggatgaactgactgccgacatcaccaac
acaccgctcggctacggcggggttgacggtgacgaacggtgggccgccgagattcgccgt
ctggcgcatttgcgcggggccaccgtcctggcgcacaactaccagctgcccgcgatccag
gacgttgccgaccacgtcggggattcgctggcgctatcgcgggtggccgccgaggcaccg
gaggacaccatcgtgttctgcggagtgcacttcatggccgagaccgccaaaattctcagc
ccgcacaaaaccgtgctgatcccggatcagcgggccggctgttcgctggccgattcgatc
acccccgacgagctgcgcgcctggaaggacgagcatcccggcgccgtcgtcgtttcctac
gtcaacaccacggcggccgtcaaggcgctcaccgacatctgctgcacctcgtcaaacgcc
gtcgacgtggtcgcatccatcgatcccgaccgcgaggtgttgttctgtccggaccaattc
ctcggtgcacacgtgcgccgggtgaccggccgcaagaacctgcatgtgtgggccggcgaa
tgccacgtacacgccgggatcaacggcgacgagctcgctgaccaggcccgcgcacatccc
gatgccgaactgttcgtgcatccggagtgtggttgcgcaacctcggcgctatacctcgcc
ggcgaaggagcattcccagccgagcgggtaaagatcttgtccaccggcggcatgctcgaa
gcggcgcacacgacgcgcgcccgccaggtgctggtcgccaccgaggtcggcatgttgcac
cagcttcgccgggcggcaccggaagtcgactttcgcgcggtcaacgaccgcgcctcatgc
aagtacatgaagatgatcacccccgcggccctgttgcgctgcctggtagagggtgccgac
gaagtccatgtcgatccgggaatcgccgccagtgggcgtcgcagcgtgcagcggatgatc
gaaatcggccatcccggcggtggcgaatga

DBGET integrated database retrieval system