KEGG   Mycobacterium tuberculosis H37Rv: Rv1595Help
Entry
Rv1595            CDS       T00015                                 

Gene name
nadB
Definition
(RefSeq) L-aspartate oxidase
  KO
K00278  
L-aspartate oxidase [EC:1.4.3.16]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Alanine, aspartate and glutamate metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Module
NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rv1595 (nadB)
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Rv1595 (nadB)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.16  L-aspartate oxidase
     Rv1595 (nadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
1795805..1797388
Genome map
AA seq 527 aa AA seqDB search
MAGPAWRDAADVVVIGTGVAGLAAALAADRAGRSVVVLSKAAQTHVTATHYAQGGIAVVL
PDNDDSVDAHVADTLAAGAGLCDPDAVYSIVADGYRAVTDLVGAGARLDESVPGRWALTR
EGGHSRRRIVHAGGDATGAEVQRALQDAAGMLDIRTGHVALRVLHDGTAVTGLLVVRPDG
CGIISAPSVILATGGLGHLYSATTNPAGSTGDGIALGLWAGVAVSDLEFIQFHPTMLFAG
RAGGRRPLITEAIRGEGAILVDRQGNSITAGVHPMGDLAPRDVVAAAIDARLKATGDPCV
YLDARGIEGFASRFPTVTASCRAAGIDPVRQPIPVVPGAHYSCGGIVTDVYGQTELLGLY
AAGEVARTGLHGANRLASNSLLEGLVVGGRAGKAAAAHAAAAGRSRATSSATWPEPISYT
ALDRGDLQRAMSRDASMYRAAAGLHRLCDSLSGAQVRDVACRRDFEDVALTLVAQSVTAA
ALARTESRGCHHRAEYPCTVPEQARSIVVRGADDANAVCVQALVAVC
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggccggtcccgcttggcgggatgcggccgatgttgtcgtgatcggcacgggcgttgcc
gggctggcggcggcattggccgccgatcgcgccgggcgcagcgtcgtggtgctcagcaag
gctgcccagacgcacgtgaccgcgacacactacgcgcaaggcggtatcgcggtggtgctg
ccggacaacgacgactcggtcgacgctcacgtcgcggacaccttggccgcaggcgcgggc
ctatgcgatcccgatgcggtgtactcgatcgtcgccgacggctaccgagcggttaccgat
ttggtcggagctggggcacggttggatgaatcggtcccgggccgttgggcgttgacgcgc
gaaggcgggcactcgcggcgacgcatcgtgcacgcgggtggcgacgcgaccggcgccgag
gttcagcgggcgctccaggatgccgccgggatgctcgatatccgcaccggccacgtggcg
ttgcgagtgctgcacgacggtaccgcggtgaccgggctattagtggtcagaccggacgga
tgcggcattatcagcgctccgtcggtgatcctggccaccggcgggctcgggcacctgtac
agcgcgaccaccaatccggcgggctccaccggcgacggcatcgccctgggattgtgggcg
ggcgtcgcggtcagcgatctcgagttcatccagttccaccccacgatgctttttgccgga
cgcgccgggggtcggcggccgctgatcaccgaggccatccgcggcgagggtgcgatcttg
gtggacaggcaaggcaattcgataacggcaggcgtgcatccgatgggtgatttggcgccg
cgcgacgtcgtcgccgccgccatcgacgcgcggctgaaggccaccggcgatccgtgcgtc
tacctcgacgcccgcggcatcgagggcttcgcgtcccggttcccgacagtcacggcatcc
tgccgggctgccggcattgaccccgtccggcaaccgatcccggttgttcccggtgcgcac
tacagctgcggcggcatagtgaccgatgtgtacggccagaccgagctgctcgggttgtac
gccgctggcgaggtggcccgcaccgggttgcacggcgccaaccgcctggcctccaacagc
ttgctagagggtttggtggtgggcggccgcgccggaaaggccgccgccgcccacgccgcg
gcggccgggcgttcgcgtgcgacctcgtcagcgacctggcccgaaccgatcagctacacc
gcactggaccgcggcgacctgcaacgggcgatgagccgggacgcgtcgatgtaccgcgcc
gccgccgggctgcaccggctgtgcgacagcctatccggagcacaggttcgcgacgtggct
tgtcgccgcgatttcgaggacgtggcgctcacgctggtcgcgcagagcgtgaccgccgcc
gccttggcccgcaccgaaagccgtggctgccatcatcgcgcggagtacccgtgcaccgtg
ccggagcaggcacgcagcatcgtggtccggggagccgacgacgcaaatgcggtgtgtgtc
caggcgctagtggcggtgtgctga

DBGET integrated database retrieval system