KEGG   Mycobacterium tuberculosis H37Rv: Rv1596Help
Entry
Rv1596            CDS       T00015                                 

Gene name
nadC
Definition
(RefSeq) nicotinate-nucleotide pyrophosphatase
  KO
K00767  
nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC:2.4.2.19]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Module
NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Rv1596 (nadC)
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.19  nicotinate-nucleotide diphosphorylase (carboxylating)
     Rv1596 (nadC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
1797388..1798245
Genome map
AA seq 285 aa AA seqDB search
MGLSDWELAAARAAIARGLDEDLRYGPDVTTLATVPASATTTASLVTREAGVVAGLDVAL
LTLNEVLGTNGYRVLDRVEDGARVPPGEALMTLEAQTRGLLTAERTMLNLVGHLSGIATA
TAAWVDAVRGTKAKIRDTRKTLPGLRALQKYAVRTGGGVNHRLGLGDAALIKDNHVAAAG
SVVDALRAVRNAAPDLPCEVEVDSLEQLDAVLPEKPELILLDNFAVWQTQTAVQRRDSRA
PTVMLESSGGLSLQTAATYAETGVDYLAVGALTHSVRVLDIGLDM
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggggttatccgactgggagctggctgcggctcgagcagcaatcgcgcgtgggctcgac
gaggacctccggtacggcccggatgtcaccacattggcgacggtgcctgccagtgcgacg
accaccgcatcgctggtgacccgggaggccggtgtggttgccggattggatgtcgcgctg
ctgacgctgaacgaagtcctgggcaccaacggttatcgggtgctcgaccgcgtcgaggac
ggcgcccgggtgccgccgggagaggcacttatgacgctggaagcccaaacgcgcggattg
ttgaccgccgagcgcaccatgttgaacctggtcggtcacctgtcgggaatcgccaccgcg
acggccgcgtgggtcgatgctgtgcgcgggaccaaagcgaaaatccgcgatacccgtaag
acgctgcccggcctgcgcgcgctgcaaaaatacgcggtgcgtaccggtggcggcgtcaac
catcggctggggttgggtgatgccgcgctaatcaaggacaaccacgttgccgccgccgga
tccgtggtagacgcgctacgtgcggtgcgaaatgctgcacccgatctgccgtgcgaggtg
gaagtggactcgcttgagcagctcgatgccgtgctgccggaaaaacccgagctgatcctg
ctggacaattttgcggtgtggcagacgcagaccgcggtgcagcgtcgggactcgcgcgcg
cccaccgtcatgctggagtcatccggtgggctcagcctgcagacggcggcgacctacgcc
gaaaccggggtggactacctggcggtcggggcgctcacacactcagtgcgcgtgctcgac
atcggcttggatatgtag

DBGET integrated database retrieval system