KEGG   Mycobacterium tuberculosis H37Rv: Rv1601Help
Entry
Rv1601            CDS       T00015                                 

Gene name
hisB
Definition
(RefSeq) imidazole glycerol-phosphate dehydratase
  KO
K01693  
imidazoleglycerol-phosphate dehydratase [EC:4.2.1.19]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rv1601 (hisB)
  Amino acid metabolism
   00340 Histidine metabolism
    Rv1601 (hisB)
Enzymes [BR:mtu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.19  imidazoleglycerol-phosphate dehydratase
     Rv1601 (hisB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
1802035..1802667
Genome map
AA seq 210 aa AA seqDB search
MTTTQTAKASRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDL
TVRATGDVEIEAHHTIEDTAIALGTALGQALGDKRGIRRFGDAFIPMDETLAHAAVDLSG
RPYCVHTGEPDHLQHTTIAGSSVPYHTVINRHVFESLAANARIALHVRVLYGRDPHHITE
AQYKAVARALRQAVEPDPRVSGVPSTKGAL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccacccagacagccaaagctagccggcgggcgcgtatcgaacggcgtacccgc
gaatccgatatcgtcatcgagctcgaccttgacggtaccgggcaggtggccgtcgacacc
ggtgttccgttctacgaccacatgttgaccgcgctgggcagtcacgccagcttcgacctc
accgtgcgcgccacaggtgatgtcgaaatcgaagcccatcacaccatcgaggacacggca
atcgcgctgggcaccgcgctcgggcaggccctaggtgacaagaggggcatccgccggttt
ggcgatgccttcatcccgatggacgaaacactggcccacgccgccgtcgacttatccggc
cgcccctattgcgtgcataccggagagccggatcacctgcagcacaccactattgccggc
agttcagtgccctaccacaccgtcatcaaccggcacgtgttcgaatcgttggcggccaac
gcccgcatcgcgctgcacgtccgcgtgttgtacgggcgcgacccgcaccatatcaccgaa
gctcaatacaaggccgtcgcgcgcgcgttgcgtcaagcggtcgagccagatcctcgggtg
tcaggcgtgccgtccaccaaaggtgctctgtga

DBGET integrated database retrieval system