KEGG   Mycobacterium tuberculosis H37Rv: Rv1602Help
Entry
Rv1602            CDS       T00015                                 

Gene name
hisH
Definition
(RefSeq) imidazole glycerol phosphate synthase subunit HisH
  KO
K02501  glutamine amidotransferase [EC:2.4.2.-]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00340  Histidine metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01230  Biosynthesis of amino acids
Module
mtu_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Rv1602 (hisH)
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.-  
     Rv1602 (hisH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase GATase_3 SNO Peptidase_C26 DJ-1_PfpI
Motif
Other DBs
NCBI-GeneID: 885529
NCBI-ProteinID: NP_216118
TubercuList: Rv1602
UniProt: P9WMM1 I6YB19
Position
1802664..1803284
Genome map
AA seq 206 aa AA seqDB search
MTAKSVVVLDYGSGNLRSAQRALQRVGAEVEVTADTDAAMTADGLVVPGVGAFAACMAGL
RKISGERIIAERVAAGRPVLGVCVGMQILFACGVEFGVQTPGCGHWPGAVIRLEAPVIPH
MGWNVVDSAAGSALFKGLDVDARFYFVHSYAAQRWEGSPDALLTWATYRAPFLAAVEDGA
LAATQFHPEKSGDAGAAVLSSWVDGL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
gtgacagcaaaatcggttgtagtccttgactacggctcaggaaacctgcggtcggcccaa
cgtgcgctgcaacgagtaggcgccgaggtcgaagtaaccgccgataccgacgccgcaatg
accgctgacggactggtggtgccgggcgtcggtgctttcgcggcgtgcatggcgggcctg
cgcaagatcagcggagagcgaatcatcgccgagcgggtggccgccggccgcccggtgctg
ggggtctgtgtcggtatgcagattctgtttgcttgcggggtcgaattcggtgtgcagacg
ccaggctgcgggcactggccgggggcggtcattcgacttgaggccccggtgattccgcac
atgggctggaatgtcgtggattccgctgcgggcagcgcgctgttcaaagggttggacgtc
gacgcccggttttatttcgtgcattcctatgccgcgcagcgatgggaaggctcacccgac
gcgctgctgacctgggccacatatcgggcgccgttcctcgctgcggtggaggacggcgca
ttggccgccacccagtttcatccggagaagagtggcgatgccggtgcagccgtactgagc
agctgggttgatggactttaa

DBGET integrated database retrieval system