KEGG   Mycobacterium tuberculosis H37Rv: Rv1602Help
Entry
Rv1602            CDS       T00015                                 

Gene name
hisH
Definition
(RefSeq) imidazole glycerol phosphate synthase subunit HisH
  KO
K02501  
glutamine amidotransferase [EC:2.4.2.-]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rv1602 (hisH)
  Amino acid metabolism
   00340 Histidine metabolism
    Rv1602 (hisH)
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.-  
     Rv1602 (hisH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
1802664..1803284
Genome map
AA seq 206 aa AA seqDB search
MTAKSVVVLDYGSGNLRSAQRALQRVGAEVEVTADTDAAMTADGLVVPGVGAFAACMAGL
RKISGERIIAERVAAGRPVLGVCVGMQILFACGVEFGVQTPGCGHWPGAVIRLEAPVIPH
MGWNVVDSAAGSALFKGLDVDARFYFVHSYAAQRWEGSPDALLTWATYRAPFLAAVEDGA
LAATQFHPEKSGDAGAAVLSSWVDGL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
gtgacagcaaaatcggttgtagtccttgactacggctcaggaaacctgcggtcggcccaa
cgtgcgctgcaacgagtaggcgccgaggtcgaagtaaccgccgataccgacgccgcaatg
accgctgacggactggtggtgccgggcgtcggtgctttcgcggcgtgcatggcgggcctg
cgcaagatcagcggagagcgaatcatcgccgagcgggtggccgccggccgcccggtgctg
ggggtctgtgtcggtatgcagattctgtttgcttgcggggtcgaattcggtgtgcagacg
ccaggctgcgggcactggccgggggcggtcattcgacttgaggccccggtgattccgcac
atgggctggaatgtcgtggattccgctgcgggcagcgcgctgttcaaagggttggacgtc
gacgcccggttttatttcgtgcattcctatgccgcgcagcgatgggaaggctcacccgac
gcgctgctgacctgggccacatatcgggcgccgttcctcgctgcggtggaggacggcgca
ttggccgccacccagtttcatccggagaagagtggcgatgccggtgcagccgtactgagc
agctgggttgatggactttaa

DBGET integrated database retrieval system