KEGG   Mycobacterium tuberculosis H37Rv: Rv1603Help
Entry
Rv1603            CDS       T00015                                 

Gene name
hisA
Definition
(RefSeq) 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase
  KO
K01814  
phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC:5.3.1.16]
K01817  
phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Histidine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rv1603 (hisA)
  Amino acid metabolism
   00340 Histidine metabolism
    Rv1603 (hisA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rv1603 (hisA)
Enzymes [BR:mtu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.16  1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase
     Rv1603 (hisA)
    5.3.1.24  phosphoribosylanthranilate isomerase
     Rv1603 (hisA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
1803294..1804031
Genome map
AA seq 245 aa AA seqDB search
MMPLILLPAVDVVEGRAVRLVQGKAGSQTEYGSAVDAALGWQRDGAEWIHLVDLDAAFGR
GSNHELLAEVVGKLDVQVELSGGIRDDESLAAALATGCARVNVGTAALENPQWCARVIGE
HGDQVAVGLDVQIIDGEHRLRGRGWETDGGDLWDVLERLDSEGCSRFVVTDITKDGTLGG
PNLDLLAGVADRTDAPVIASGGVSSLDDLRAIATLTHRGVEGAIVGKALYARRFTLPQAL
AAVRD
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtgatgccgctgatacttttgcccgccgtcgacgtggtcgagggtcgtgccgtgcgcctc
gttcaagggaaggccggcagccaaaccgagtacggctcagcggtggatgccgcgttgggc
tggcaacgcgatggcgccgagtggatccatttggtggacctggatgctgcgttcggccgc
ggttccaaccacgaactgcttgccgaggttgtcggcaagctcgacgtacaggttgagcta
tccggcggtattcgagacgacgagtcgctggccgcggcgctggccaccggatgcgctcgg
gtcaatgtgggcactgctgccctggaaaacccgcagtggtgtgcccgggtgattggcgag
cacggcgaccaggtcgccgtcggcttggacgtccagatcatcgacggcgagcatcggttg
cgcggacgcggctgggaaaccgacggcggcgacctgtgggacgtgctagaacgcctagac
agtgaaggatgttcgcggttcgtcgtgaccgatatcaccaaggacggcaccctgggcggc
cccaatctggacctgctggccggtgttgccgaccgcaccgacgccccggtgatcgcgtcc
ggaggtgtgtccagcctcgatgacctgcgcgccattgcgactctcacgcaccgcggcgtc
gagggggccatcgtcggcaaggccctctacgcccgtcggttcaccttgccgcaagcgttg
gccgcggttcgggactag

DBGET integrated database retrieval system