KEGG   Mycobacterium tuberculosis H37Rv: Rv1606Help
Entry
Rv1606            CDS       T00015                                 

Gene name
hisI
Definition
(RefSeq) phosphoribosyl-AMP cyclohydrolase
  KO
K01496  
phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rv1606 (hisI)
  Amino acid metabolism
   00340 Histidine metabolism
    Rv1606 (hisI)
Enzymes [BR:mtu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     Rv1606 (hisI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
1805653..1806000
Genome map
AA seq 115 aa AA seqDB search
MTLDPKIAARLKRNADGLVTAVVQERGSGDVLMVAWMNDEALARTLQTREATYYSRSRAE
QWVKGATSGHTQHVHSVRLDCDGDAVLLTVDQVGGACHTGDHSCFDAAVLLEPDD
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgacactcgacccaaagatcgcggcgcggttgaagcgtaatgccgacggactggttacc
gccgtcgtccaggagcggggcagcggtgacgtgctgatggttgcctggatgaacgacgag
gccttggcccgtaccctgcaaacccgtgaggccacttactattcgcgatcccgtgccgaa
caatgggtcaagggcgcgacgtccggccacacccagcacgttcactcggtgcgcctggat
tgtgacggcgacgccgtattgttgacggttgaccaggtcggcggtgcctgccataccggc
gatcacagttgcttcgatgccgcggtgttgttagaacccgacgactaa

DBGET integrated database retrieval system