KEGG   Mycobacterium tuberculosis H37Rv: Rv1609Help
Entry
Rv1609            CDS       T00015                                 

Gene name
trpE
Definition
(RefSeq) anthranilate synthase component I
  KO
K01657  
anthranilate synthase component I [EC:4.1.3.27]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Quorum sensing
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rv1609 (trpE)
  Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    Rv1609 (trpE)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Rv1609 (trpE)
Enzymes [BR:mtu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     Rv1609 (trpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
1807903..1809453
Genome map
AA seq 516 aa AA seqDB search
MHADLAATTSREDFRLLAAEHRVVPVTRKVLADSETPLSAYRKLAANRPGTFLLESAENG
RSWSRWSFIGAGAPTALTVREGQAVWLGAVPKDAPTGGDPLRALQVTLELLATADRQSEP
GLPPLSGGMVGFFAYDMVRRLERLPERAVDDLCLPDMLLLLATDVAAVDHHEGTITLIAN
AVNWNGTDERVDWAYDDAVARLDVMTAALGQPLPSTVATFSRPEPRHRAQRTVEEYGAIV
EYLVDQIAAGEAFQVVPSQRFEMDTDVDPIDVYRILRVTNPSPYMYLLQVPNSDGAVDFS
IVGSSPEALVTVHEGWATTHPIAGTRWRGRTDDEDVLLEKELLADDKERAEHLMLVDLGR
NDLGRVCTPGTVRVEDYSHIERYSHVMHLVSTVTGKLGEGRTALDAVTACFPAGTLSGAP
KVRAMELIEEVEKTRRGLYGGVVGYLDFAGNADFAIAIRTALMRNGTAYVQAGGGVVADS
NGSYEYNEARNKARAVLNAIAAAETLAAPGANRSGC
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
gtgcacgccgacctcgcagccaccacctcgcgtgaggatttccgcctcctggcggccgag
caccgggtggttccggtgactcgcaaggtcttggccgacagcgagacgccgctgtcggcc
taccgcaagctcgccgccaatcgcccgggtacgttcctgctggagtcggccgagaacggc
cggtcgtggtcgcgatggtcgtttatcggtgcgggggcgccaacggcgttgaccgtgcgt
gaggggcaagcggtatggctgggtgccgtgcccaaggacgctcccactggcggagacccg
ctgcgggcgctgcaggtgaccttggagctgctggctacggcggatcgtcagtccgagccg
ggtcttccgccgctgtcgggtggcatggtcggtttcttcgcctatgacatggtgcgacgg
ctggaacgattgccggaacgggccgtcgatgacctctgcctgccggacatgctgctgttg
ctggccaccgatgtggcggcggtcgatcaccacgagggcaccatcacgttgatcgccaac
gccgtgaactggaacggcaccgacgagcgggtcgactgggcctacgacgacgcggtcgct
cggctggacgtgatgaccgcagcgctcggccaaccactaccgtcaaccgtggccaccttc
agccgacccgagccgcgccaccgtgcgcaacgcaccgtcgaagaatatggtgcgatcgtc
gaatacttggtggatcagattgcagccggtgaagcgttccaggtggtgccctcgcagcgc
ttcgagatggacaccgatgtcgatcccatcgacgtgtaccgaattctgcgggtaaccaac
ccaagtccctacatgtatctactgcaggtgccgaatagtgatggtgcagtggacttttcg
attgttggatccagtccggaggcgctggtaacggtccacgaaggctgggcgacgacgcat
ccgatcgccggaacccggtggcgcggaaggacagacgacgaggacgtgcttctggaaaaa
gagctgctggcggacgacaaagaacgtgccgagcatctgatgctggtcgacctcggccga
aacgacctgggtcgggtctgcacgccgggcactgttcgggtcgaggattacagccacatc
gagcggtacagccacgtgatgcacctggtgtccacggtgaccgggaagctcggcgaaggg
cgcaccgcgctggacgcggtgaccgcctgctttccggccggcacgctgtcgggcgcgccg
aaggtgcgggcgatggagctgatcgaagaggtggagaagacacgccgcggcctttacggc
ggtgtcgtcggttaccttgacttcgccggcaacgctgacttcgccatcgccatccgcacc
gcgctgatgcgtaacggcacggcttatgtccaggcaggcggtggtgtggtggccgactcc
aacggatcctacgaatacaacgaggcgaggaacaaggctcgggctgtgctcaacgcgatc
gctgccgccgagacgctggccgctccgggcgcgaaccgcagtggctgctaa

DBGET integrated database retrieval system