KEGG   Mycobacterium tuberculosis H37Rv: Rv1609Help
Entry
Rv1609            CDS       T00015                                 

Gene name
trpE
Definition
(RefSeq) anthranilate synthase component I
  KO
K01657  
anthranilate synthase component I [EC:4.1.3.27]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Quorum sensing
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rv1609 (trpE)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rv1609 (trpE)
  Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    Rv1609 (trpE)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Rv1609 (trpE)
Enzymes [BR:mtu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     Rv1609 (trpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
1807903..1809453
Genome map
AA seq 516 aa AA seqDB search
MHADLAATTSREDFRLLAAEHRVVPVTRKVLADSETPLSAYRKLAANRPGTFLLESAENG
RSWSRWSFIGAGAPTALTVREGQAVWLGAVPKDAPTGGDPLRALQVTLELLATADRQSEP
GLPPLSGGMVGFFAYDMVRRLERLPERAVDDLCLPDMLLLLATDVAAVDHHEGTITLIAN
AVNWNGTDERVDWAYDDAVARLDVMTAALGQPLPSTVATFSRPEPRHRAQRTVEEYGAIV
EYLVDQIAAGEAFQVVPSQRFEMDTDVDPIDVYRILRVTNPSPYMYLLQVPNSDGAVDFS
IVGSSPEALVTVHEGWATTHPIAGTRWRGRTDDEDVLLEKELLADDKERAEHLMLVDLGR
NDLGRVCTPGTVRVEDYSHIERYSHVMHLVSTVTGKLGEGRTALDAVTACFPAGTLSGAP
KVRAMELIEEVEKTRRGLYGGVVGYLDFAGNADFAIAIRTALMRNGTAYVQAGGGVVADS
NGSYEYNEARNKARAVLNAIAAAETLAAPGANRSGC
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
gtgcacgccgacctcgcagccaccacctcgcgtgaggatttccgcctcctggcggccgag
caccgggtggttccggtgactcgcaaggtcttggccgacagcgagacgccgctgtcggcc
taccgcaagctcgccgccaatcgcccgggtacgttcctgctggagtcggccgagaacggc
cggtcgtggtcgcgatggtcgtttatcggtgcgggggcgccaacggcgttgaccgtgcgt
gaggggcaagcggtatggctgggtgccgtgcccaaggacgctcccactggcggagacccg
ctgcgggcgctgcaggtgaccttggagctgctggctacggcggatcgtcagtccgagccg
ggtcttccgccgctgtcgggtggcatggtcggtttcttcgcctatgacatggtgcgacgg
ctggaacgattgccggaacgggccgtcgatgacctctgcctgccggacatgctgctgttg
ctggccaccgatgtggcggcggtcgatcaccacgagggcaccatcacgttgatcgccaac
gccgtgaactggaacggcaccgacgagcgggtcgactgggcctacgacgacgcggtcgct
cggctggacgtgatgaccgcagcgctcggccaaccactaccgtcaaccgtggccaccttc
agccgacccgagccgcgccaccgtgcgcaacgcaccgtcgaagaatatggtgcgatcgtc
gaatacttggtggatcagattgcagccggtgaagcgttccaggtggtgccctcgcagcgc
ttcgagatggacaccgatgtcgatcccatcgacgtgtaccgaattctgcgggtaaccaac
ccaagtccctacatgtatctactgcaggtgccgaatagtgatggtgcagtggacttttcg
attgttggatccagtccggaggcgctggtaacggtccacgaaggctgggcgacgacgcat
ccgatcgccggaacccggtggcgcggaaggacagacgacgaggacgtgcttctggaaaaa
gagctgctggcggacgacaaagaacgtgccgagcatctgatgctggtcgacctcggccga
aacgacctgggtcgggtctgcacgccgggcactgttcgggtcgaggattacagccacatc
gagcggtacagccacgtgatgcacctggtgtccacggtgaccgggaagctcggcgaaggg
cgcaccgcgctggacgcggtgaccgcctgctttccggccggcacgctgtcgggcgcgccg
aaggtgcgggcgatggagctgatcgaagaggtggagaagacacgccgcggcctttacggc
ggtgtcgtcggttaccttgacttcgccggcaacgctgacttcgccatcgccatccgcacc
gcgctgatgcgtaacggcacggcttatgtccaggcaggcggtggtgtggtggccgactcc
aacggatcctacgaatacaacgaggcgaggaacaaggctcgggctgtgctcaacgcgatc
gctgccgccgagacgctggccgctccgggcgcgaaccgcagtggctgctaa

DBGET integrated database retrieval system