KEGG   Mycobacterium tuberculosis H37Rv: Rv1617Help
Entry
Rv1617            CDS       T00015                                 

Gene name
pykA
Definition
(RefSeq) pyruvate kinase
  KO
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rv1617 (pykA)
   01230 Biosynthesis of amino acids
    Rv1617 (pykA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv1617 (pykA)
   00620 Pyruvate metabolism
    Rv1617 (pykA)
  Nucleotide metabolism
   00230 Purine metabolism
    Rv1617 (pykA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     Rv1617 (pykA)
Exosome [BR:mtu04147]
 Exosomal proteins
  Proteins found in most exosomes
   Rv1617 (pykA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
1816189..1817607
Genome map
AA seq 472 aa AA seqDB search
MTRRGKIVCTLGPATQRDDLVRALVEAGMDVARMNFSHGDYDDHKVAYERVRVASDATGR
AVGVLADLQGPKIRLGRFASGATHWAEGETVRITVGACEGSHDRVSTTYKRLAQDAVAGD
RVLVDDGKVALVVDAVEGDDVVCTVVEGGPVSDNKGISLPGMNVTAPALSEKDIEDLTFA
LNLGVDMVALSFVRSPADVELVHEVMDRIGRRVPVIAKLEKPEAIDNLEAIVLAFDAVMV
ARGDLGVELPLEEVPLVQKRAIQMARENAKPVIVATQMLDSMIENSRPTRAEASDVANAV
LDGADALMLSGETSVGKYPLAAVRTMSRIICAVEENSTAAPPLTHIPRTKRGVISYAARD
IGERLDAKALVAFTQSGDTVRRLARLHTPLPLLAFTAWPEVRSQLAMTWGTETFIVPKMQ
STDGMIRQVDKSLLELARYKRGDLVVIVAGAPPGTVGSTNLIHVHRIGEDDV
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
gtgacgagacgcgggaaaatcgtctgcactctcgggccggccacccagcgggacgacctg
gtcagagcgctggtcgaggccggaatggacgtcgcccgaatgaacttcagccacggcgac
tacgacgatcacaaggtcgcctatgagcgggtccgggtagcctccgacgccaccgggcgc
gcggtcggcgtgctcgccgacctgcagggcccgaagatcaggttgggacgcttcgcctcc
ggggccacccactgggccgaaggcgaaaccgtccggatcaccgtgggcgcctgcgagggc
agccacgatcgggtgtccaccacctacaagcggctagcccaggacgcggtggccggtgac
cgggtgctggtcgacgacggcaaagtcgcattggtggtcgacgccgtcgagggcgacgac
gtggtctgcaccgtcgtcgaaggcggcccggtcagcgacaacaagggcatctcgttgccc
ggaatgaacgtgaccgcgccggccctgtcggagaaggacatcgaggatctcacgttcgcg
ctgaacctcggcgtcgacatggtggcgctttccttcgtccgctccccggccgatgtcgaa
ctggtccacgaggtgatggatcggatcgggcgacgggtgccggtgatcgccaagctggag
aagccggaagccatcgacaatctcgaagcgatcgtgctggcgttcgacgccgtcatggtc
gctcggggcgacctaggtgttgagctgccgctcgaagaggtcccgctggtacagaagcga
gccatccagatggcccgggagaacgccaagccggtcattgtggcgacccagatgctcgac
tcgatgatcgagaactcgcggccgacccgagctgaggcctccgacgtcgccaacgcggtg
ctcgatggcgccgacgcgctgatgctgtccggggaaacctcggtagggaagtaccccctt
gctgcggtccggacaatgtcgcgcatcatctgcgcggtcgaggagaactccacggccgca
ccgccgttgacacacattccccggaccaagcgtggggtcatctcgtatgcggcccgtgac
atcggcgaacgactcgacgccaaggccttggtggccttcactcagtccggtgataccgtg
cggcgactggcccgcctgcataccccgctgccgctgctggccttcaccgcgtggcccgag
gtgcgcagccaactggcgatgacctggggcaccgagacgttcatcgtgccgaagatgcag
tccaccgatggcatgatccgccaggtcgacaaatcgctgctcgaactcgcccgctacaag
cgtggtgacttggtggtcatcgtcgcgggtgcgccgccaggcacagtgggttcgaccaac
ctgatccacgtgcaccggatcggggaagatgacgtctag

DBGET integrated database retrieval system