KEGG   Mycobacterium tuberculosis H37Rv: Rv1623cHelp
Entry
Rv1623c           CDS       T00015                                 

Gene name
cydA
Definition
(RefSeq) cytochrome D ubiquinol oxidase subunit I CydA
  KO
K00425  
cytochrome d ubiquinol oxidase subunit I [EC:1.10.3.14]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Oxidative phosphorylation
Metabolic pathways
Two-component system
Module
Cytochrome d ubiquinol oxidase
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Rv1623c (cydA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rv1623c (cydA)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.14  ubiquinol oxidase (electrogenic, non H+-transporting)
     Rv1623c (cydA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(1824430..1825887)
Genome map
AA seq 485 aa AA seqDB search
MNVVDISRWQFGITTVYHFIFVPLTIGLAPLIAVMQTLWVVTDNPAWYRLTKFFGKLFLI
NFAIGVATGIVQEFQFGMNWSEYSRFVGDVFGAPLAMEGLAAFFFESTFIGLWIFGWNRL
PRLVHLACIWIVAIAVNVSAFFIIAANSFMQHPVGAHYNPTTGRAELSSIVVLLTNNTAQ
AAFTHTVSGALLTAGTFVAAVSAWWLVRSSTTHADSDTQAMYRPATILGCWVALAATAGL
LFTGDHQGKLMFQQQPMKMASAESLCDTQTDPNFSVLTVGRQNNCDSLTRVIEVPYVLPF
LAEGRISGVTLQGIRDLQQEYQQRFGPNDYRPNLFVTYWSFRMMIGLMAIPVLFALIALW
LTRGGQIPNQRWFSWLALLTMPAPFLANSAGWVFTEMGRQPWVVVPNPTGDQLVRLTVKA
GVSDHSATVVATSLLMFTLVYAVLAVIWCWLLKRYIVEGPLEHDAEPAAHGAPRDDEVAP
LSFAY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtcgtcgacatttcgcggtggcagttcggtatcaccaccgtctatcacttcatt
ttcgtaccgctgaccatcggcctggccccgctgatcgcggtcatgcaaacgctgtgggtc
gtcaccgataaccccgcctggtatcgcctcaccaaattcttcggcaaattgttcctgatc
aactttgccatcggcgtggcgaccggaatcgtgcaggaatttcagttcggcatgaactgg
agcgagtactcccgattcgtcggcgatgtcttcggcgccccgctggccatggagggcctg
gcggccttcttcttcgaatccaccttcatcgggttgtggatcttcggctggaacaggctg
ccccggctggtgcatctggcctgcatctggatcgtcgcaatcgcggtcaacgtgtccgcg
ttcttcatcatcgcggcaaactccttcatgcagcatccggtcggcgcgcactacaacccg
accaccgggcgtgccgagttgagcagcatcgtcgtgctgctgaccaacaacaccgcacag
gcggcgtttacccacactgtcagcggtgcgctgctgaccgccgggaccttcgtcgccgcg
gtgagcgcctggtggctggtccgttcgagcaccacgcacgccgactcagatacccaagcc
atgtatcgtcccgcgaccatcctggggtgttgggttgcgttggccgccacggccgggttg
ttgttcaccggcgaccaccaaggcaagctgatgttccagcagcagccgatgaagatggcg
tcggccgaatcgttgtgcgatacccagacagatccaaacttctctgtcctgacggtcggc
cggcaaaacaactgcgacagcctcacccgtgtcatcgaagtgccctatgtgttgccgttc
ctcgccgagggccggatcagcggtgtgacgttgcagggtatccgcgatctgcagcaggaa
taccagcagcgcttcggaccaaacgactaccggcccaacctcttcgtcacctactggtca
tttcgcatgatgatcgggttgatggcgatcccggtgctgttcgcactgattgcgctctgg
ctcacccgtggcggccagatccccaatcaacgctggttctcctggctggcgctgctaacc
atgcccgccccgttcctggccaacagcgccggatgggtgttcaccgagatggggcgccag
ccctgggtcgtcgtccctaacccgaccggtgatcagctggttcgactcaccgtcaaagca
ggcgtctcggatcactccgccaccgtggtcgccacgtctttgctgatgttcaccttggtc
tacgcggtacttgcggtcatctggtgctggctgctcaagcgttacatcgtcgaaggcccc
ctggaacacgacgcggaaccggctgcgcacggggcaccccgcgacgacgaggtagcacca
ttgtcgtttgcttactga

DBGET integrated database retrieval system