KEGG   Mycobacterium tuberculosis H37Rv: Rv1625cHelp
Entry
Rv1625c           CDS       T00015                                 

Gene name
cya
Definition
(RefSeq) adenylate cyclase
  KO
K01768  
adenylate cyclase [EC:4.6.1.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Rv1625c (cya)
Enzymes [BR:mtu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     Rv1625c (cya)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1826614..1827945)
Genome map
AA seq 443 aa AA seqDB search
MAARKCGAPPIAADGSTRRPDCVTAVRTQARAPTQHYAESVARRQRVLTITAWLAVVVTG
SFALMQLATGAGGWYIALINVFTAVTFAIVPLLHRFGGLVAPLTFIGTAYVAIFAIGWDV
GTDAGAQFFFLVAAALVVLLVGIEHTALAVGLAAVAAGLVIALEFLVPPDTGLQPPWAMS
VSFVLTTVSACGVAVATVWFALRDTARAEAVMEAEHDRSEALLANMLPASIAERLKEPER
NIIADKYDEASVLFADIVGFTERASSTAPADLVRFLDRLYSAFDELVDQHGLEKIKVSGD
SYMVVSGVPRPRPDHTQALADFALDMTNVAAQLKDPRGNPVPLRVGLATGPVVAGVVGSR
RFFYDVWGDAVNVASRMESTDSVGQIQVPDEVYERLKDDFVLRERGHINVKGKGVMRTWY
LIGRKVAADPGEVRGAEPRTAGV
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
gtggcggcaagaaaatgcggcgccccaccgatagcagcggatggctcgacacgacgccca
gactgtgtcacggccgtgcgcactcaggcccgcgctcccacgcagcactacgccgaaagc
gtcgcgcggcggcagcgcgtgcttaccatcaccgcctggctcgctgtcgtggtaaccggg
agcttcgcgctaatgcaactagcgaccggggccgggggctggtacatcgccctgatcaac
gtcttcaccgcggttactttcgcgatcgtgcccctgctacatcgcttcgggggattggtg
gcaccgcttacgttcatcggcaccgcctatgtggcgatcttcgccatcggctgggatgtg
ggcaccgacgcgggtgcccagttcttcttcttggtagccgccgcgttggtggtgttgctg
gtcggcatcgaacacaccgcgttagcggtgggcctagcggcggtcgccgccggtctggtg
attgccctggagttcctggtcccgcccgatactgggcttcagccgccctgggccatgtcg
gtaagtttcgtcctcacgaccgtctccgcctgcggggtagcggtcgcaacggtgtggttc
gcgctgcgtgatactgcgcgcgcggaggcggtcatggaggcggagcacgaccgctccgaa
gcactgctggccaacatgttgccggccagcatcgccgagcggcttaaagaacccgagcga
aacatcatcgccgataaatacgacgaggcctcggtgctgttcgccgacatcgtcgggttc
accgaacgcgccagtagcaccgcgccggcggacctggtccggttcctggaccgcctctac
agcgctttcgacgagctggtcgaccagcacgggctggagaaaatcaaggtcagcggggac
tcctacatggttgtcagcggcgttccgcggccccggcctgaccatacgcaagcactggcg
gactttgcgctcgacatgaccaatgtcgcagcgcaattgaaggatccacgcggcaacccg
gtgccgctgcgggtgggcctggccaccggcccggtggtggcgggtgtggtgggttctcga
cggttcttctacgacgtgtggggcgacgcggtcaatgtcgcgtcgcggatggaatccacc
gattcggtggggcaaattcaggtgccagacgaggtttacgagcgtctcaaggacgacttc
gtgttgcgcgagcgcggccacataaacgtcaaggggaaaggcgtaatgcgcacgtggtac
ctcatcggccgcaaggtagccgcagatcccggcgaggtgcgcggggccgaaccccgcacg
gcaggggtctga

DBGET integrated database retrieval system