KEGG   Mycobacterium tuberculosis H37Rv: Rv1631Help
Entry
Rv1631            CDS       T00015                                 

Gene name
coaE
Definition
(RefSeq) dephospho-CoA kinase CoaE
  KO
K00859  
dephospho-CoA kinase [EC:2.7.1.24]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Module
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Rv1631 (coaE)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.24  dephospho-CoA kinase
     Rv1631 (coaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
1835013..1836236
Genome map
AA seq 407 aa AA seqDB search
MLRIGLTGGIGAGKSLLSTTFSQCGGIVVDGDVLAREVVQPGTEGLASLVDAFGRDILLA
DGALDRQALAAKAFRDDESRGVLNGIVHPLVARRRSEIIAAVSGDAVVVEDIPLLVESGM
APLFPLVVVVHADVELRVRRLVEQRGMAEADARARIAAQASDQQRRAVADVWLDNSGSPE
DLVRRARDVWNTRVQPFAHNLAQRQIARAPARLVPADPSWPDQARRIVNRLKIACGHKAL
RVDHIGSTAVSGFPDFLAKDVIDIQVTVESLDVADELAEPLLAAGYPRLEHITQDTEKTD
ARSTVGRYDHTDSAALWHKRVHASADPGRPTNVHLRVHGWPNQQFALLFVDWLAANPGAR
EDYLTVKCDADRRADGELARYVTAKEPWFLDAYQRAWEWADAVHWRP
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcatcgggctgaccggcggcattggcgccgggaagtcgttgctgtccacgacg
ttctcgcaatgcggcggaatcgttgtcgacggcgatgtgttggcgcgtgaagtggtccag
ccgggcaccgaggggctggcctcgctggtcgacgcgttcggtcgcgacatcctgcttgca
gacggagcgctggaccggcaggcgttggcggccaaggcgtttcgagatgacgagtcgcgc
ggtgtgctcaacggaatcgtgcacccgctggtcgcccggcgccgatccgagatcatcgcg
gcggtttcgggggacgcggttgtggtcgaagatattccactgctggtggaatccgggatg
gcgccattgtttccgctggtggtggtggtgcacgccgacgtcgagctacgggtgcgacgg
ctggtcgagcaacgcggcatggccgaagccgacgcccgggctaggatcgctgcgcaggcc
agcgaccagcagcgtcgtgccgtcgccgacgtctggctggacaactcgggcagcccagag
gatttggtgcggcgggcccgcgacgtctggaacacgcgcgtccagcccttcgcgcacaac
ctggcccaacgtcagattgcgcgcgcgccggctaggttggtgccggcggatccaagctgg
ccggatcaggcgcggcgcatcgtcaaccggctaaagatcgcgtgcgggcataaggccttg
cgagttgaccacattgggtcaaccgccgtgtcgggcttccccgattttctagccaaggat
gtcatcgacatccaggtcaccgtcgaatcacttgacgtggccgacgagctggccgagccc
ttgctggccgccggctacccacgcctcgagcacatcacccaggacaccgaaaagaccgac
gctcgcagcaccgtcggccgctacgaccacaccgacagtgccgctctgtggcacaagcgc
gtgcacgcctcggcggatcccggtcggccgaccaacgtgcacctgcgggtgcacggctgg
cccaaccaacagttcgccctgctgttcgtcgactggctggcggccaatcccggcgcgaga
gaagactatttgacggtcaagtgtgacgccgacaggcgcgccgacggtgagctcgcgcgc
tacgtcaccgccaaggagccgtggttcctggatgcctaccagcgggcatgggagtgggcg
gatgcggtgcactggcgtccctga

DBGET integrated database retrieval system