KEGG   Mycobacterium tuberculosis H37Rv: Rv1652Help
Entry
Rv1652            CDS       T00015                                 

Gene name
argC
Definition
(RefSeq) N-acetyl-gamma-glutamyl-phoshate reductase
  KO
K00145  
N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Arginine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Rv1652 (argC)
   01230 Biosynthesis of amino acids
    Rv1652 (argC)
  Amino acid metabolism
   00220 Arginine biosynthesis
    Rv1652 (argC)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.38  N-acetyl-gamma-glutamyl-phosphate reductase
     Rv1652 (argC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
1865576..1866634
Genome map
AA seq 352 aa AA seqDB search
MQNRQVANATKVAVAGASGYAGGEILRLLLGHPAYADGRLRIGALTAATSAGSTLGEHHP
HLTPLAHRVVEPTEAAVLGGHDAVFLALPHGHSAVLAQQLSPETLIIDCGADFRLTDAAV
WERFYGSSHAGSWPYGLPELPGARDQLRGTRRIAVPGCYPTAALLALFPALAADLIEPAV
TVVAVSGTSGAGRAATTDLLGAEVIGSARAYNIAGVHRHTPEIAQGLRAVTDRDVSVSFT
PVLIPASRGILATCTARTRSPLSQLRAAYEKAYHAEPFIYLMPEGQLPRTGAVIGSNAAH
IAVAVDEDAQTFVAIAAIDNLVKGTAGAAVQSMNLALGWPETDGLSVVGVAP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatcggcaggtggccaatgcgacgaaggtggcggttgccggtgccagcggatat
gccggtggtgagattctccgcctgctgctcgggcatccggcgtacgccgacggccggctg
aggatcggtgcgctgaccgcggcgaccagcgccggcagcacgctcggcgaacaccatccg
cacctgacgccgctggcccatcgagtagtcgaacccaccgaagctgccgtgctcggtggc
catgacgccgtcttcttggccttgccgcacgggcattcggcggtgttggcgcagcaactg
agccccgagacactgatcatcgactgcggggcggactttcggctcaccgacgccgccgtc
tgggagcggttctacgggtcgtcgcacgccggtagctggccgtatgggttgcccgagctg
ccgggcgcgcgggaccaattgcgcggcacccgccgcatcgcggtgcccggctgctatccg
accgcggcactgctggcgctttttcccgcgctggccgcagaccttatcgagcccgcggtg
accgtggtcgccgtgagcggtacctcgggggcgggtcgtgcggccaccaccgacttgctg
ggcgcggaggtcatcgggtcggcgcgcgcctacaacatcgccggcgtccaccggcacacc
cccgagatcgctcaagggctacgcgcggtcaccgaccgcgacgtctcggtctcgtttacc
ccggtgctgatcccggcctcccgtggcatcctggccacctgcacggcacgcacccgatca
cccctgtcgcagctgcgggcagcctacgaaaaggcctaccatgcagagcctttcatttat
ctgatgccggaggggcagctgccgcgcaccggcgcggtgatcggcagcaacgcagcgcac
atcgccgtcgcggtggacgaggacgcgcagacgttcgtggcgatcgccgcgatcgacaac
ctggtcaagggcaccgccggcgccgcggtgcaatcgatgaacctggcgctgggctggccg
gagaccgacggcctttcggttgtgggggtggcgccgtga

DBGET integrated database retrieval system