KEGG   Mycobacterium tuberculosis H37Rv: Rv1652Help
Entry
Rv1652            CDS       T00015                                 

Gene name
argC
Definition
(RefSeq) N-acetyl-gamma-glutamyl-phoshate reductase
  KO
K00145  N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00220  Arginine biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
mtu01210  2-Oxocarboxylic acid metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Rv1652 (argC)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.38  N-acetyl-gamma-glutamyl-phosphate reductase
     Rv1652 (argC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dhC Semialdhyde_dh
Motif
Other DBs
NCBI-GeneID: 885278
NCBI-ProteinID: NP_216168
TubercuList: Rv1652
UniProt: P9WPZ9 I6Y733
Structure
PDB: 

Jmol
Position
1865576..1866634
Genome map
AA seq 352 aa AA seqDB search
MQNRQVANATKVAVAGASGYAGGEILRLLLGHPAYADGRLRIGALTAATSAGSTLGEHHP
HLTPLAHRVVEPTEAAVLGGHDAVFLALPHGHSAVLAQQLSPETLIIDCGADFRLTDAAV
WERFYGSSHAGSWPYGLPELPGARDQLRGTRRIAVPGCYPTAALLALFPALAADLIEPAV
TVVAVSGTSGAGRAATTDLLGAEVIGSARAYNIAGVHRHTPEIAQGLRAVTDRDVSVSFT
PVLIPASRGILATCTARTRSPLSQLRAAYEKAYHAEPFIYLMPEGQLPRTGAVIGSNAAH
IAVAVDEDAQTFVAIAAIDNLVKGTAGAAVQSMNLALGWPETDGLSVVGVAP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatcggcaggtggccaatgcgacgaaggtggcggttgccggtgccagcggatat
gccggtggtgagattctccgcctgctgctcgggcatccggcgtacgccgacggccggctg
aggatcggtgcgctgaccgcggcgaccagcgccggcagcacgctcggcgaacaccatccg
cacctgacgccgctggcccatcgagtagtcgaacccaccgaagctgccgtgctcggtggc
catgacgccgtcttcttggccttgccgcacgggcattcggcggtgttggcgcagcaactg
agccccgagacactgatcatcgactgcggggcggactttcggctcaccgacgccgccgtc
tgggagcggttctacgggtcgtcgcacgccggtagctggccgtatgggttgcccgagctg
ccgggcgcgcgggaccaattgcgcggcacccgccgcatcgcggtgcccggctgctatccg
accgcggcactgctggcgctttttcccgcgctggccgcagaccttatcgagcccgcggtg
accgtggtcgccgtgagcggtacctcgggggcgggtcgtgcggccaccaccgacttgctg
ggcgcggaggtcatcgggtcggcgcgcgcctacaacatcgccggcgtccaccggcacacc
cccgagatcgctcaagggctacgcgcggtcaccgaccgcgacgtctcggtctcgtttacc
ccggtgctgatcccggcctcccgtggcatcctggccacctgcacggcacgcacccgatca
cccctgtcgcagctgcgggcagcctacgaaaaggcctaccatgcagagcctttcatttat
ctgatgccggaggggcagctgccgcgcaccggcgcggtgatcggcagcaacgcagcgcac
atcgccgtcgcggtggacgaggacgcgcagacgttcgtggcgatcgccgcgatcgacaac
ctggtcaagggcaccgccggcgccgcggtgcaatcgatgaacctggcgctgggctggccg
gagaccgacggcctttcggttgtgggggtggcgccgtga

DBGET integrated database retrieval system