KEGG   Mycobacterium tuberculosis H37Rv: Rv1656Help
Entry
Rv1656            CDS       T00015                                 

Gene name
argF
Definition
(RefSeq) ornithine carbamoyltransferase
  KO
K00611  
ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Arginine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rv1656 (argF)
  Amino acid metabolism
   00220 Arginine biosynthesis
    Rv1656 (argF)
Enzymes [BR:mtu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     Rv1656 (argF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
1869922..1870845
Genome map
AA seq 307 aa AA seqDB search
MIRHFLRDDDLSPAEQAEVLELAAELKKDPVSRRPLQGPRGVAVIFDKNSTRTRFSFELG
IAQLGGHAVVVDSGSTQLGRDETLQDTAKVLSRYVDAIVWRTFGQERLDAMASVATVPVI
NALSDEFHPCQVLADLQTIAERKGALRGLRLSYFGDGANNMAHSLLLGGVTAGIHVTVAA
PEGFLPDPSVRAAAERRAQDTGASVTVTADAHAAAAGADVLVTDTWTSMGQENDGLDRVK
PFRPFQLNSRLLALADSDAIVLHCLPAHRGDEITDAVMDGPASAVWDEAENRLHAQKALL
VWLLERS
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaggcatttcctgcgcgacgacgatctgtccccggccgaacaggccgaggtgctc
gagctcgcggccgagctgaagaaagacccggttagccgtcgtcccctgcaagggccgcgc
ggggtggcggtcatcttcgacaagaactccacccgcacccggttctccttcgagctgggc
atcgcgcagctgggcgggcatgccgtcgtcgtcgacagcggcagcacccagctgggccgc
gacgaaaccctgcaggacaccgcaaaggtgttgtcccgctacgtcgatgccatcgtctgg
cgaaccttcggccaagagcggctggacgccatggcgtcggtcgcgacggtgcccgtgatc
aacgcgctctccgatgagttccatccgtgtcaggtgttggccgacctgcagaccatcgcc
gaacgcaagggggcgctgcgcggcctgaggttgtcctacttcggcgacggcgccaacaac
atggcccactcgctgctgctcggcggggtcaccgcgggtatccacgtcaccgtcgcggct
cccgagggcttcctgcccgacccgtcggtgcgggccgcggccgagcgccgcgcccaggat
accggcgcctcggtgactgtgaccgccgacgcccacgcggccgccgccggcgccgacgtt
ctggtcaccgacacctggacgtcgatgggccaggaaaacgacgggttggaccgagtgaag
ccgtttcggccgtttcagctcaactcgcgacttctggcgctggccgactcggatgccatc
gtgttgcattgcctgccggcccatcgcggcgacgagatcaccgacgcggtgatggacggg
ccggccagcgcggtgtgggacgaggccgaaaaccggctgcacgcgcagaaggcgctgctg
gtgtggctgctggagcgctcatga

DBGET integrated database retrieval system