KEGG   Mycobacterium tuberculosis H37Rv: Rv1658Help
Entry
Rv1658            CDS       T00015                                 

Gene name
argG
Definition
(RefSeq) argininosuccinate synthase
  KO
K01940  argininosuccinate synthase [EC:6.3.4.5]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00220  Arginine biosynthesis
mtu00250  Alanine, aspartate and glutamate metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
mtu01230  Biosynthesis of amino acids
Module
mtu_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rv1658 (argG)
   00220 Arginine biosynthesis
    Rv1658 (argG)
Enzymes [BR:mtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     Rv1658 (argG)
Exosome [BR:mtu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rv1658 (argG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginosuc_synth QueC
Motif
Other DBs
NCBI-GeneID: 885645
NCBI-ProteinID: NP_216174
TubercuList: Rv1658
UniProt: P9WPW7 I6XYK2
Position
1871363..1872559
Genome map
AA seq 398 aa AA seqDB search
MSERVILAYSGGLDTSVAISWIGKETGREVVAVAIDLGQGGEHMDVIRQRALDCGAVEAV
VVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIVKHLVAAAREHGGGIVAHGCTG
KGNDQVRFEVGFASLAPDLEVLAPVRDYAWTREKAIAFAEENAIPINVTKRSPFSIDQNV
WGRAVETGFLEHLWNAPTKDIYAYTEDPTINWGVPDEVIVGFERGVPVSVDGKPVSMLAA
IEELNRRAGAQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHTELEHVTLERELGRFK
RQTDQRWAELVYDGLWYSPLKAALEAFVAKTQEHVSGEVRLVLHGGHIAVNGRRSAESLY
DFNLATYDEGDSFDQSAARGFVYVHGLSSKLAARRDLR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagcgcgtcatcctggcctattccggcggtctggacacctcggtggcgatcagc
tggataggcaaggagaccggccgtgaggtggtggcggtggcgatcgacctcgggcagggc
ggcgagcacatggacgtcatacggcagcgggcgctggactgcggcgcggtggaggctgtc
gtcgtcgacgcccgcgacgagttcgccgaaggctactgcctgcccaccgtgctgaacaac
gcgctgtacatggaccgctacccgctggtgtcggcgatcagccggccgctgatcgtcaaa
cacctggtcgccgcggcgcgcgagcacggcggcggcatcgtcgcgcacggctgcaccggc
aagggcaacgaccaggtccggttcgaagtcgggttcgcctcgctggcaccggatttagag
gtgttggcgccggtgcgcgactacgcgtggacgcgggagaaggcgatcgcgttcgccgag
gagaacgcgatcccgatcaacgtcaccaaacgttcgccgttctccatcgaccagaacgtc
tggggccgcgcggtggagaccggcttcttagagcacctgtggaatgccccaaccaaggac
atctacgcctacaccgaagaccccacgatcaactggggggtccccgacgaggtgatcgtc
ggcttcgaacgcggcgtgccggtgtccgtcgacggcaagccggtgtcgatgctggcggcg
atcgaggagctcaaccgccgcgccggagcgcaaggtgtcgggcgcctcgacgtcgtggag
gatcggctggtgggcatcaagagccgcgagatctacgaggcgcccggcgcgatggtgctg
atcaccgcgcacaccgaactcgaacacgtcaccctggagcgtgagctgggccggttcaaa
cgccagaccgaccagcgctgggccgaactggtctacgacgggctgtggtactcgccgctg
aaggccgcgctggaggctttcgtcgccaagacccaggagcacgtgtccggcgaggtgcgg
ctggtgctacacggcggccacatcgcggtcaacggccggcgcagcgcggaatcgttgtac
gacttcaacctggccacctacgacgagggcgacagcttcgaccagtccgccgcccgcggc
ttcgtctacgtgcacgggctgtcctccaagctcgccgcccgccgggatctgcggtga

DBGET integrated database retrieval system