KEGG   Mycobacterium tuberculosis H37Rv: Rv1658Help
Entry
Rv1658            CDS       T00015                                 

Gene name
argG
Definition
(RefSeq) argininosuccinate synthase
  KO
K01940  
argininosuccinate synthase [EC:6.3.4.5]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rv1658 (argG)
   00220 Arginine biosynthesis
    Rv1658 (argG)
Enzymes [BR:mtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     Rv1658 (argG)
Exosome [BR:mtu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rv1658 (argG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
1871363..1872559
Genome map
AA seq 398 aa AA seqDB search
MSERVILAYSGGLDTSVAISWIGKETGREVVAVAIDLGQGGEHMDVIRQRALDCGAVEAV
VVDARDEFAEGYCLPTVLNNALYMDRYPLVSAISRPLIVKHLVAAAREHGGGIVAHGCTG
KGNDQVRFEVGFASLAPDLEVLAPVRDYAWTREKAIAFAEENAIPINVTKRSPFSIDQNV
WGRAVETGFLEHLWNAPTKDIYAYTEDPTINWGVPDEVIVGFERGVPVSVDGKPVSMLAA
IEELNRRAGAQGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHTELEHVTLERELGRFK
RQTDQRWAELVYDGLWYSPLKAALEAFVAKTQEHVSGEVRLVLHGGHIAVNGRRSAESLY
DFNLATYDEGDSFDQSAARGFVYVHGLSSKLAARRDLR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagcgcgtcatcctggcctattccggcggtctggacacctcggtggcgatcagc
tggataggcaaggagaccggccgtgaggtggtggcggtggcgatcgacctcgggcagggc
ggcgagcacatggacgtcatacggcagcgggcgctggactgcggcgcggtggaggctgtc
gtcgtcgacgcccgcgacgagttcgccgaaggctactgcctgcccaccgtgctgaacaac
gcgctgtacatggaccgctacccgctggtgtcggcgatcagccggccgctgatcgtcaaa
cacctggtcgccgcggcgcgcgagcacggcggcggcatcgtcgcgcacggctgcaccggc
aagggcaacgaccaggtccggttcgaagtcgggttcgcctcgctggcaccggatttagag
gtgttggcgccggtgcgcgactacgcgtggacgcgggagaaggcgatcgcgttcgccgag
gagaacgcgatcccgatcaacgtcaccaaacgttcgccgttctccatcgaccagaacgtc
tggggccgcgcggtggagaccggcttcttagagcacctgtggaatgccccaaccaaggac
atctacgcctacaccgaagaccccacgatcaactggggggtccccgacgaggtgatcgtc
ggcttcgaacgcggcgtgccggtgtccgtcgacggcaagccggtgtcgatgctggcggcg
atcgaggagctcaaccgccgcgccggagcgcaaggtgtcgggcgcctcgacgtcgtggag
gatcggctggtgggcatcaagagccgcgagatctacgaggcgcccggcgcgatggtgctg
atcaccgcgcacaccgaactcgaacacgtcaccctggagcgtgagctgggccggttcaaa
cgccagaccgaccagcgctgggccgaactggtctacgacgggctgtggtactcgccgctg
aaggccgcgctggaggctttcgtcgccaagacccaggagcacgtgtccggcgaggtgcgg
ctggtgctacacggcggccacatcgcggtcaacggccggcgcagcgcggaatcgttgtac
gacttcaacctggccacctacgacgagggcgacagcttcgaccagtccgccgcccgcggc
ttcgtctacgtgcacgggctgtcctccaagctcgccgcccgccgggatctgcggtga

DBGET integrated database retrieval system